Protein Info for DZA65_RS22375 in Dickeya dianthicola ME23

Annotation: F0F1 ATP synthase subunit A

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 263 transmembrane" amino acids 23 to 45 (23 residues), see Phobius details amino acids 85 to 103 (19 residues), see Phobius details amino acids 139 to 158 (20 residues), see Phobius details amino acids 203 to 225 (23 residues), see Phobius details amino acids 233 to 257 (25 residues), see Phobius details TIGR01131: ATP synthase F0, A subunit" amino acids 21 to 258 (238 residues), 142.9 bits, see alignment E=7.3e-46 PF00119: ATP-synt_A" amino acids 31 to 257 (227 residues), 190.7 bits, see alignment E=1.6e-60

Best Hits

Swiss-Prot: 89% identical to ATP6_PECAS: ATP synthase subunit a (atpB) from Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)

KEGG orthology group: K02108, F-type H+-transporting ATPase subunit a [EC: 3.6.3.14] (inferred from 97% identity to ddc:Dd586_4153)

Predicted SEED Role

"ATP synthase F0 sector subunit a"

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.14

Use Curated BLAST to search for 3.6.3.14

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4DDH0 at UniProt or InterPro

Protein Sequence (263 amino acids)

>DZA65_RS22375 F0F1 ATP synthase subunit A (Dickeya dianthicola ME23)
MSASTPQEYIGHHLTHLQVGTGFWAINVDSMFFSVVLGVLFLAIFRKVAKTATSGVPGKL
QTAVELVVGFIDGSVRDMFHGKSKLIAPLALTVFVWVFMMNMMDLLPIDLLPQIWAHIYS
ALGHDPAHAYLRVVPSADVNVTLSMALGVFILILFYSIKMKGVGGFVKELTMQPFNHPIF
IPINLILEGVSLLSKPVSLGLRLFGNMYAGELIFILIAGLLPWWSQWILNVPWAIFHILI
ITLQAFIFMVLTVVYLSMASEEH