Protein Info for DZA65_RS22310 in Dickeya dianthicola ME23

Annotation: ribose ABC transporter ATP-binding protein RbsA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 505 PF00005: ABC_tran" amino acids 21 to 169 (149 residues), 110.9 bits, see alignment E=7.8e-36 amino acids 268 to 423 (156 residues), 91.1 bits, see alignment E=1e-29

Best Hits

Swiss-Prot: 89% identical to RBSA_PECAS: Ribose import ATP-binding protein RbsA (rbsA) from Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)

KEGG orthology group: K10441, ribose transport system ATP-binding protein [EC: 3.6.3.17] (inferred from 98% identity to ddd:Dda3937_02356)

MetaCyc: 84% identical to ribose ABC transporter ATP binding subunit (Escherichia coli K-12 substr. MG1655)
ABC-28-RXN

Predicted SEED Role

"Ribose ABC transport system, ATP-binding protein RbsA (TC 3.A.1.2.1)" in subsystem D-ribose utilization (TC 3.A.1.2.1)

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.17

Use Curated BLAST to search for 3.6.3.17

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A385Y3F1 at UniProt or InterPro

Protein Sequence (505 amino acids)

>DZA65_RS22310 ribose ABC transporter ATP-binding protein RbsA (Dickeya dianthicola ME23)
MQPLLQLQGITKTFPGVKALSGAALNVYPGKVMALVGENGAGKSTMMKVLTGIYRKDAGS
IHFLGKDVDFSGPKASQEAGIGIIHQELNLIPQLTIAENIFLGREFTNRLGRIDWKRMYA
EADKLLKRLNLRYDSRRLVGELSIGDQQMVEIAKVLSFESQVIIMDEPTDALTDTETASL
FGVIKELQSQGCGIVYISHRLKEIFEICDDVTVFRDGQFIGERPVNELQEDSLIEMMVGR
KLEEQYPRLNQAPGEVRLQVSELSGPGVENVSFTLCKGEILGVAGLMGAGRTELMKVLYG
ALPRTHGKVHLDGKDVVTRSPQDGLASGIVYISEDRKHDGLVLGMSVKENMSLTALRYFS
NAAGSLRHGDEQQAVSDFIRMFNIRTPSMSQPIGLLSGGNQQKVAIARGLMTRPRVLILD
EPTRGVDVGAKKEIYQLINQFKQEGLSIILVSSEMPEVLGMSDRIIVMHEGRLSGEFPIE
QATQETLMAAAVGKQYGVKQEISQT