Protein Info for DZA65_RS22305 in Dickeya dianthicola ME23

Annotation: ribose ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 322 transmembrane" amino acids 22 to 42 (21 residues), see Phobius details amino acids 49 to 69 (21 residues), see Phobius details amino acids 74 to 92 (19 residues), see Phobius details amino acids 98 to 119 (22 residues), see Phobius details amino acids 126 to 146 (21 residues), see Phobius details amino acids 170 to 190 (21 residues), see Phobius details amino acids 221 to 240 (20 residues), see Phobius details amino acids 252 to 268 (17 residues), see Phobius details amino acids 275 to 293 (19 residues), see Phobius details amino acids 299 to 316 (18 residues), see Phobius details PF02653: BPD_transp_2" amino acids 45 to 314 (270 residues), 148.7 bits, see alignment E=9.4e-48

Best Hits

Swiss-Prot: 85% identical to RBSC_ECOL6: Ribose import permease protein RbsC (rbsC) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K10440, ribose transport system permease protein (inferred from 97% identity to dze:Dd1591_4173)

MetaCyc: 85% identical to ribose ABC transporter membrane subunit (Escherichia coli K-12 substr. MG1655)
ABC-28-RXN

Predicted SEED Role

"Ribose ABC transport system, permease protein RbsC (TC 3.A.1.2.1)" in subsystem D-ribose utilization (TC 3.A.1.2.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4CHH5 at UniProt or InterPro

Protein Sequence (322 amino acids)

>DZA65_RS22305 ribose ABC transporter permease (Dickeya dianthicola ME23)
MSSQTIAAKRWPSKEWLMEQKSLIALLILIAVVSSMSPNFFTLNNLFNILQQTSVNAIMA
VGMTLVILTSGIDLSVGSLLALTGAVAASIIGLEINALVAVFAALALGAVIGAGTGIVIA
KGRVQAFIATLVMMLLLRGVTMVYTSGSPINTGFSDAADALGWFGIGRPLGIPTPIWIMA
VVFLATWYMLHHTRIGRYIYALGGNEAATRLSGISVDRVKVVVYSLCGLLSALAGIIEVA
RLSSAQPTAGTGYELDAIAAVVLGGTSLSGGKGRVVGTLIGALILGFLNNGLNLLGVSSY
YQMIVKAVVILLAVLVDNKGSK