Protein Info for DZA65_RS22260 in Dickeya dianthicola ME23

Annotation: molybdopterin-guanine dinucleotide biosynthesis protein B

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 175 TIGR00176: molybdopterin-guanine dinucleotide biosynthesis protein B" amino acids 7 to 165 (159 residues), 156.3 bits, see alignment E=3.1e-50 PF03205: MobB" amino acids 7 to 140 (134 residues), 160.8 bits, see alignment E=8.5e-52

Best Hits

KEGG orthology group: K03753, molybdopterin-guanine dinucleotide biosynthesis protein B (inferred from 91% identity to ddd:Dda3937_01107)

Predicted SEED Role

"Molybdopterin-guanine dinucleotide biosynthesis protein MobB" in subsystem Molybdenum cofactor biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4CIN4 at UniProt or InterPro

Protein Sequence (175 amino acids)

>DZA65_RS22260 molybdopterin-guanine dinucleotide biosynthesis protein B (Dickeya dianthicola ME23)
MTDIPLLAIVAHSGTGKTTLLKQLIPLLNAMGIRVGIIKHTHHDMDVDKPGKDSYELRKA
GADQTLVASNTRWALMTETPEQQEPNLYFLASRMDSSKLDLILVEGFKHEPVDKILLHRH
GSGGDAVALIDTCTLAVASDTALALALPCLDLNQPAQIATFISDWLRRRTGAAGN