Protein Info for DZA65_RS22175 in Dickeya dianthicola ME23

Annotation: AsmA family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 581 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details

Best Hits

Swiss-Prot: 49% identical to YICH_ECOLI: AsmA family protein YicH (yicH) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 96% identity to ddd:Dda3937_01123)

Predicted SEED Role

"FIG01200701: possible membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4CCJ1 at UniProt or InterPro

Protein Sequence (581 amino acids)

>DZA65_RS22175 AsmA family protein (Dickeya dianthicola ME23)
MKLIGKLLLTLLLLALLAVVVLYVLAQTEWGARHISQWVNQRTEYQVSFRKMAHDWSAPR
RIQLLDVNFGHKNQPVTLIAQSVSAGFSVRQITDPRHFSSLMLEGGTLNLGQTGFTLPIE
ADVLQLKAMALHAQDGDWRLRGEQVTGGITPWQPEPGYLLGKKAAFQLSAHSLLLNDLPA
SKVLVQGQLNNQQLTLENFGADVARGELTGNASRAEDGSWLVNNLRLSNVRLQTRQSMAD
FWQPVARLPAVTVNRFDLIDARIEGQNWAFTDLDVTLQNVTFRQNDWQSDDGSLSFNATD
IVNGNMHLVDPIVSLDLSKQGVNIKQFSTRWEGGLLRTSGNWLRSNQRLTLDELVVAGME
YTLPADWRQRWQQTLPDWLAEVELRKFSANHNLLIDINPAFPFQLTALDGVGSNLLLARN
HQWGVWQGALNLNASDATFNKVDIRRPSLALNANDNQITLTDLSAFTQSGLLEAKAVIAQ
QPARIFTLDLTGKAVAFDVLTRWGWPAPATAPTGNTNLQLHLNGRLEATSPLRPTLNGTL
QGIDSAGRAISQAMHQETVADSAPALSTPPTAPAASPAAQP