Protein Info for DZA65_RS22070 in Dickeya dianthicola ME23

Annotation: arsenic resistance protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 333 transmembrane" amino acids 19 to 35 (17 residues), see Phobius details amino acids 41 to 62 (22 residues), see Phobius details amino acids 74 to 96 (23 residues), see Phobius details amino acids 102 to 120 (19 residues), see Phobius details amino acids 132 to 152 (21 residues), see Phobius details amino acids 165 to 187 (23 residues), see Phobius details amino acids 199 to 224 (26 residues), see Phobius details amino acids 237 to 256 (20 residues), see Phobius details amino acids 268 to 286 (19 residues), see Phobius details amino acids 292 to 312 (21 residues), see Phobius details PF01758: SBF" amino acids 47 to 199 (153 residues), 26.9 bits, see alignment E=1.8e-10

Best Hits

KEGG orthology group: None (inferred from 92% identity to ddd:Dda3937_01143)

Predicted SEED Role

"Arsenical-resistance protein ACR3" in subsystem Arsenic resistance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A385Y3P4 at UniProt or InterPro

Protein Sequence (333 amino acids)

>DZA65_RS22070 arsenic resistance protein (Dickeya dianthicola ME23)
MPTSLLSCWSGWLERRQTAIYLLTLLVAAVLAWRWPPSDTLAQAINPALALMLFVTFLQL
PLSRLLEALTHLRFMLALAATNFVAIPLLVALLLRLWPLESLVAVGVAIVLLCPCVDYVV
TFSHQGGADSRLLLAATPLLLVLQMLLLPLWLPLLLPQTTALNIGMAPFLHAFIVLMALP
LLLAAAVQRWAARYSAGAAIAGWLGLLPVPATALVLALIIAFVVPRLGLATGAVRQALPV
YLLFAVLAPALGWLMARLWSLPAPSGRALVFSGATRNALVILPLAIPDALPVIPAVVVTQ
TLVELLAELVYIRWVPRLRFAGKPPHSTAPSKK