Protein Info for DZA65_RS22010 in Dickeya dianthicola ME23

Annotation: NAD(P)/FAD-dependent oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 394 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details PF07992: Pyr_redox_2" amino acids 4 to 161 (158 residues), 33.9 bits, see alignment E=9.7e-12 PF03486: HI0933_like" amino acids 4 to 391 (388 residues), 517.5 bits, see alignment E=9.2e-159 PF00890: FAD_binding_2" amino acids 5 to 49 (45 residues), 33.3 bits, see alignment 1.3e-11 PF12831: FAD_oxidored" amino acids 5 to 159 (155 residues), 30.9 bits, see alignment E=7.4e-11 TIGR00275: flavoprotein, HI0933 family" amino acids 6 to 391 (386 residues), 427.4 bits, see alignment E=2.5e-132 PF13450: NAD_binding_8" amino acids 8 to 39 (32 residues), 22.5 bits, see alignment (E = 4.5e-08)

Best Hits

Swiss-Prot: 78% identical to YHIN_ECOLI: Uncharacterized protein YhiN (yhiN) from Escherichia coli (strain K12)

KEGG orthology group: K07007, (no description) (inferred from 94% identity to dze:Dd1591_4118)

Predicted SEED Role

"NAD(FAD)-utilizing dehydrogenases"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A385Y350 at UniProt or InterPro

Protein Sequence (394 amino acids)

>DZA65_RS22010 NAD(P)/FAD-dependent oxidoreductase (Dickeya dianthicola ME23)
MEQFDVIIIGAGAAGLFCAAQAGQKGLRALLVDNGKKPGRKILMSGGGRCNFTNLYAEPA
AYLSNNPHFCKSALARYTQWDFISLVNRHGIAYHEKTLGQLFCDDSAQHIVDMLMKECDA
GKVTLRLRSDVLSVEKNTLFQVNLNTGVVQARALVIATGGLSMPGLGATPVGYQLAAQFG
LNVLPTRAALVPFTLHKPLLEQLQTLSGVSVPAVVTAENGTTFRENILFTHRGLSGPAIL
QLSSYWQPGEFVTINLLPTLDLAENLNAERQAHPNQSLKNTLSQWLPKRLVECLQALEQL
PDVTLKQLNKSQQTEVETTLQQWRVQPNGTEGYRTAEVTLGGVDTRELSSKTMEAGKMPG
LYFIGEVVDVTGWLGGYNFQWAWSSAWACAQALG