Protein Info for DZA65_RS21880 in Dickeya dianthicola ME23

Annotation: cellulose synthase operon protein YhjQ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 271 PF06564: CBP_BcsQ" amino acids 1 to 241 (241 residues), 114.7 bits, see alignment E=1.5e-36 TIGR03371: cellulose synthase operon protein YhjQ" amino acids 1 to 246 (246 residues), 168.6 bits, see alignment E=8.5e-54 PF13614: AAA_31" amino acids 3 to 57 (55 residues), 50.8 bits, see alignment E=5.8e-17 PF01656: CbiA" amino acids 4 to 224 (221 residues), 68.8 bits, see alignment E=1.3e-22 PF09140: MipZ" amino acids 4 to 42 (39 residues), 23.8 bits, see alignment 8e-09 PF10609: ParA" amino acids 4 to 41 (38 residues), 35.5 bits, see alignment 2.2e-12 PF02374: ArsA_ATPase" amino acids 7 to 54 (48 residues), 27.2 bits, see alignment 6.9e-10

Best Hits

KEGG orthology group: None (inferred from 93% identity to ddd:Dda3937_01989)

Predicted SEED Role

"Cellulose synthase, putative"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A385Y370 at UniProt or InterPro

Protein Sequence (271 amino acids)

>DZA65_RS21880 cellulose synthase operon protein YhjQ (Dickeya dianthicola ME23)
MPLVCVCSPKGGVGKTTVAANLAYALARGGSKVLAIDFDVQNALRLHFGVPLGDERGYVA
KSDDAADWSQSILTTDDNIFVLPYGSVTEDQRLTFEHNLVSDPLFLKRGLSTVMNYPGLV
IVADFPPGPSPALKAMTDLADLHLMVMMADTASLSLMPFIEDNKLTGQHLNRKKGYYLLL
NQTDNRRTISSQVSSFVQQRMPDKLIGSVHRDESVAEANASQRSIFDFSPVSAAAFDIEL
IGKRVAALLDIRIGTGEVHADFPAYQTVPAS