Protein Info for DZA65_RS21850 in Dickeya dianthicola ME23

Annotation: dicarboxylate/amino acid:cation symporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 428 transmembrane" amino acids 9 to 28 (20 residues), see Phobius details amino acids 44 to 64 (21 residues), see Phobius details amino acids 76 to 99 (24 residues), see Phobius details amino acids 141 to 164 (24 residues), see Phobius details amino acids 184 to 208 (25 residues), see Phobius details amino acids 219 to 241 (23 residues), see Phobius details amino acids 296 to 317 (22 residues), see Phobius details amino acids 326 to 345 (20 residues), see Phobius details amino acids 350 to 374 (25 residues), see Phobius details PF00375: SDF" amino acids 9 to 401 (393 residues), 389.6 bits, see alignment E=8.7e-121

Best Hits

Swiss-Prot: 87% identical to DCTA_PECAS: C4-dicarboxylate transport protein (dctA) from Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)

KEGG orthology group: K11103, aerobic C4-dicarboxylate transport protein (inferred from 97% identity to ddd:Dda3937_01995)

MetaCyc: 88% identical to C4 dicarboxylate/orotate:H+ symporter (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-121; TRANS-RXN-121A; TRANS-RXN-121C; TRANS-RXN-122A; TRANS-RXN0-451; TRANS-RXN0-517; TRANS-RXN0-553

Predicted SEED Role

"Aerobic C4-dicarboxylate transporter for fumarate, L-malate, D-malate, succunate" in subsystem Pyruvate metabolism I: anaplerotic reactions, PEP

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4DGW3 at UniProt or InterPro

Protein Sequence (428 amino acids)

>DZA65_RS21850 dicarboxylate/amino acid:cation symporter (Dickeya dianthicola ME23)
MKKSIFKSLYFQVLVAITIGISLGHFYPGLGQQMQPLGDGFVKLIKMVIAPVIFCTVVTG
IAGMESMKAVGRTGAIALLYFEVVSTLALIIGLVVVNVLQPGAGMNVDPASLNVAAVANY
ATEAGKQGVVPFLMDVIPSSVIGAFASGNILQVLLFAVMFGFALHRLGEKGVLIFDVIES
FSNVIFGIINMIMRLAPIGAFGAMAFTIGKYGVGTLVQLGQLIICFYITCILFVVLVLGS
IARATGFSIFKFIRYIREELLIVLGTSSSESALPRMLEKMEKLGCKKSVVGLVIPTGYSF
NLDGTSIYLTMAAVFIAQATNSHMDIWHQITLLVVLLLSSKGAAGVTGSGFIVLAATISA
VGHLPLAGLALILGIDRFMSEARALTNLVGNGVATVVVAKWCKQLDSKQMDNVLSGRDNG
PATESRPS