Protein Info for DZA65_RS21785 in Dickeya dianthicola ME23

Annotation: lysoplasmalogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 209 signal peptide" amino acids 1 to 19 (19 residues), see Phobius details transmembrane" amino acids 42 to 65 (24 residues), see Phobius details amino acids 76 to 97 (22 residues), see Phobius details amino acids 103 to 123 (21 residues), see Phobius details amino acids 131 to 152 (22 residues), see Phobius details amino acids 160 to 178 (19 residues), see Phobius details amino acids 190 to 208 (19 residues), see Phobius details PF07947: YhhN" amino acids 26 to 207 (182 residues), 130.7 bits, see alignment E=2.4e-42

Best Hits

Swiss-Prot: 54% identical to YHHN_ECOLI: Uncharacterized membrane protein YhhN (yhhN) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 95% identity to ddd:Dda3937_02008)

Predicted SEED Role

"probable enzyme yhhN"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4DAG3 at UniProt or InterPro

Protein Sequence (209 amino acids)

>DZA65_RS21785 lysoplasmalogenase (Dickeya dianthicola ME23)
MLWSFIAVFFSGWLYVDASYRGPVWQRWLFKPVTLLLMMLMVWQTPTLGIPGYLVVLGLA
ATLVGDALMQLSGERLRFALSAYLASHLLYTISFFAFRPSLGFFWPLPLTLIILSALLLA
LLWSRLKAERLTVTALVLVTAFMAWVAGEHYFALGNESNFSLLVGTLLLFAGHAIWLVNH
FRVNFRAHQALVAIGYFGGHFLIVRSLYI