Protein Info for DZA65_RS21755 in Dickeya dianthicola ME23

Annotation: cell division protein FtsX

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 323 transmembrane" amino acids 43 to 66 (24 residues), see Phobius details amino acids 185 to 213 (29 residues), see Phobius details amino acids 239 to 262 (24 residues), see Phobius details amino acids 266 to 288 (23 residues), see Phobius details amino acids 294 to 314 (21 residues), see Phobius details TIGR00439: putative protein insertion permease FtsX" amino acids 24 to 323 (300 residues), 428.1 bits, see alignment E=9.7e-133 PF18075: FtsX_ECD" amino acids 81 to 175 (95 residues), 51.4 bits, see alignment E=1.4e-17 PF02687: FtsX" amino acids 198 to 313 (116 residues), 48.2 bits, see alignment E=1e-16

Best Hits

Swiss-Prot: 73% identical to FTSX_ECOL6: Cell division protein FtsX (ftsX) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K09811, cell division transport system permease protein (inferred from 96% identity to ddd:Dda3937_02014)

Predicted SEED Role

"Cell division protein FtsX" in subsystem Bacterial Cell Division

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A385Y3M4 at UniProt or InterPro

Protein Sequence (323 amino acids)

>DZA65_RS21755 cell division protein FtsX (Dickeya dianthicola ME23)
MANNTRMQRAGNKTKTRSLQGGWQEQWRYAWANALRDMLRQPLATLLTIMVIAISLTLPS
VCYLVWKNVSQAASQWYPTPQLTVYLDKSLDDNAAEVVIGKIKAEEGVDKVNYLSRNEAM
GEFRNWSGFGGALDMLEENPLPAVAVVSPKLSFQNNQTLNTLRDRIAAVQGVAEVRMDDS
WFSRLVALTGLVGQVAATIGILMVAAVFLVIGNSVRLSIFSRRDTINVMKLIGATDGFIL
RPFLHGGALLGCCGAVLSLILSQALVWKLSGAVTQVAAVFGTTFAVRGLGWDEALLLILI
AVMIGWLAAWLATVQHLRRFTPE