Protein Info for DZA65_RS21640 in Dickeya dianthicola ME23

Annotation: AEC family transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 318 transmembrane" amino acids 12 to 29 (18 residues), see Phobius details amino acids 41 to 59 (19 residues), see Phobius details amino acids 71 to 91 (21 residues), see Phobius details amino acids 103 to 125 (23 residues), see Phobius details amino acids 131 to 153 (23 residues), see Phobius details amino acids 172 to 191 (20 residues), see Phobius details amino acids 203 to 223 (21 residues), see Phobius details amino acids 234 to 258 (25 residues), see Phobius details amino acids 264 to 281 (18 residues), see Phobius details amino acids 292 to 315 (24 residues), see Phobius details PF03547: Mem_trans" amino acids 16 to 310 (295 residues), 94.7 bits, see alignment E=2.2e-31

Best Hits

KEGG orthology group: K07088, (no description) (inferred from 98% identity to ddd:Dda3937_03046)

Predicted SEED Role

"putative membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4D1C8 at UniProt or InterPro

Protein Sequence (318 amino acids)

>DZA65_RS21640 AEC family transporter (Dickeya dianthicola ME23)
MPTFILSLWHQIFLSLPLFVLIALGYALIRFGRWPSTVTDALTKFVFSVALPAMLFRMMC
DFSKRPAVDARLLIAFFGSCLIVFVLGRLVASRIFRLDGVSGSVFSLSGIFSNNVMLGLP
IATLMLGPQAIPSVALVLVFNGLILWTLVTISVEWARNGSLSMQGFTKTALGVLKNPLII
GILSGTFYSLTGLPLPESIDKPIGMLSQIGVPLSLVALGMGLAEYRIRDGWQISVAICFI
KLLVQPLVVWVLAVALGLPEMETRVVVLLGSMAVGVNIYLMSRQFNVLGGPVAASLLMST
ALAGITTPLILTLMGVRV