Protein Info for DZA65_RS21580 in Dickeya dianthicola ME23

Annotation: CDF family cation-efflux transporter FieF

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details transmembrane" amino acids 30 to 59 (30 residues), see Phobius details amino acids 80 to 104 (25 residues), see Phobius details amino acids 118 to 138 (21 residues), see Phobius details amino acids 158 to 175 (18 residues), see Phobius details amino acids 181 to 199 (19 residues), see Phobius details TIGR01297: cation diffusion facilitator family transporter" amino acids 12 to 287 (276 residues), 236 bits, see alignment E=2.6e-74 PF01545: Cation_efflux" amino acids 14 to 206 (193 residues), 160.5 bits, see alignment E=4.6e-51 PF16916: ZT_dimer" amino acids 210 to 287 (78 residues), 87.7 bits, see alignment E=4.6e-29

Best Hits

Swiss-Prot: 79% identical to FIEF_PECCP: Cation-efflux pump FieF (fieF) from Pectobacterium carotovorum subsp. carotovorum (strain PC1)

KEGG orthology group: K13283, ferrous-iron efflux pump FieF (inferred from 96% identity to ddd:Dda3937_03866)

MetaCyc: 74% identical to Zn2+/Fe2+/Cd2+ exporter (Escherichia coli K-12 substr. MG1655)
RXN0-6; TRANS-RXN0-200; TRANS-RXN0-244

Predicted SEED Role

"Cobalt-zinc-cadmium resistance protein" in subsystem Cobalt-zinc-cadmium resistance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4CZK6 at UniProt or InterPro

Protein Sequence (300 amino acids)

>DZA65_RS21580 CDF family cation-efflux transporter FieF (Dickeya dianthicola ME23)
MNSHYARLVTTAAFLATATALSLFGMKMYAWWYTGSVSLLASLVDSLVDIAASLVNLLVV
RYSLQPADTEHTFGHGKAEALAALAQSMFISGSALFLLLTGAQHLITPQPLQGPELGMWI
TIIALAATGLLVSFQRWVIRKTHSQAVRADMLHYQSDVLMNGAILLSLALSWKGINWADA
VFALGIGVYILGSALRMAYEAIQVLLDRALPDEERQEIANLISSWPGVSGAHQLRTRRSG
PTRFIQLHLEMADNLPLVESHQIADGLEQALLNRFPGSDVIIHQDPVSVVPQEQRGRWDL