Protein Info for DZA65_RS21550 in Dickeya dianthicola ME23

Annotation: YiiQ family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 197 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details PF07305: DUF1454" amino acids 14 to 196 (183 residues), 267.7 bits, see alignment E=2.3e-84

Best Hits

Swiss-Prot: 56% identical to YIIQ_ECOLI: Uncharacterized protein YiiQ (yiiQ) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 97% identity to ddc:Dd586_3949)

Predicted SEED Role

"Putative uncharacterized protein YiiQ"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A385Y4U7 at UniProt or InterPro

Protein Sequence (197 amino acids)

>DZA65_RS21550 YiiQ family protein (Dickeya dianthicola ME23)
MKNALLIVCCLSAGLLCTPFARSDGLFQQKPPTAAPYLLSGSPTFDMNIVQFRTRYNLSN
PSLPISEYRVVDTGDDSPNLTRAASRINDHLYSSTALEKGTGKIKTMQITWLPKPKDTDQ
SGRRKQAIGYMAALVRTFMPSLTNEQSLKKIETLLEKGKGQRFYQQTEGALRYVVADHGE
KGLTFAVEPIKLTLSDS