Protein Info for DZA65_RS21525 in Dickeya dianthicola ME23

Annotation: aquaporin family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 281 transmembrane" amino acids 15 to 37 (23 residues), see Phobius details amino acids 48 to 80 (33 residues), see Phobius details amino acids 88 to 110 (23 residues), see Phobius details amino acids 147 to 168 (22 residues), see Phobius details amino acids 180 to 203 (24 residues), see Phobius details amino acids 233 to 253 (21 residues), see Phobius details PF00230: MIP" amino acids 8 to 253 (246 residues), 216.9 bits, see alignment E=1.6e-68 TIGR00861: MIP family channel proteins" amino acids 15 to 253 (239 residues), 239.8 bits, see alignment E=1.5e-75

Best Hits

Swiss-Prot: 80% identical to GLPF_ECOL6: Glycerol uptake facilitator protein (glpF) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K02440, glycerol uptake facilitator protein (inferred from 96% identity to ddd:Dda3937_03877)

MetaCyc: 80% identical to glycerol facilitator (Escherichia coli K-12 substr. MG1655)
RXN0-7189; RXN0-7191; TRANS-RXN-131; TRANS-RXN0-460; TRANS-RXN0-536; TRANS-RXN0-537; TRANS-RXN0-551

Predicted SEED Role

"Glycerol uptake facilitator protein" in subsystem Glycerol and Glycerol-3-phosphate Uptake and Utilization or Glycerol fermenation to 1,3-propanediol

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4CMZ0 at UniProt or InterPro

Protein Sequence (281 amino acids)

>DZA65_RS21525 aquaporin family protein (Dickeya dianthicola ME23)
MSQSELSTLKGQCIAEFLGTGLLIFFGVGCVAALKLAGASFGQWEISIIWGLGVAMAIYL
TAAISGAHLNPAVTIALWLFACFDARKVLPYILSQVAGAFCSAALVYGLYHNLFDNIEQT
HNMVRGSVESLDLAGVFSTYPNPHISVLQAFLVETVITAILMCLILALTDDGNGIPRGPL
APLLIGILIAVIGASMGPLTGFAMNPARDAGPKLFAYFAGWGKIALTGGRDIPYMLIPIF
GPIVGACLGAFGYRILIGRNLPCDVCAIDDDTAASAQTRKV