Protein Info for DZA65_RS21435 in Dickeya dianthicola ME23

Annotation: YijD family membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 124 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details transmembrane" amino acids 34 to 52 (19 residues), see Phobius details amino acids 64 to 83 (20 residues), see Phobius details amino acids 90 to 109 (20 residues), see Phobius details PF07226: DUF1422" amino acids 3 to 115 (113 residues), 180.3 bits, see alignment E=5.4e-58

Best Hits

Swiss-Prot: 61% identical to YIJD_ECO57: Inner membrane protein YijD (yijD) from Escherichia coli O157:H7

KEGG orthology group: None (inferred from 96% identity to ddc:Dd586_3926)

Predicted SEED Role

"Putative inner membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4CGI1 at UniProt or InterPro

Protein Sequence (124 amino acids)

>DZA65_RS21435 YijD family membrane protein (Dickeya dianthicola ME23)
MTEQINSEKSTLVLALVAGLSANGSFVAVFSSIVPFSIFPLIALVLSVYCLHQRYMHHAM
PKGTPLLAAGCFLFGLLLYSAIVRAEYPQIGSNFVPSILCVVLALWLVVKLRARKPDSGE
INTP