Protein Info for DZA65_RS21255 in Dickeya dianthicola ME23
Annotation: UDP-N-acetylglucosamine--undecaprenyl-phosphate N-acetylglucosaminephosphotransferase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 68% identical to WECA_YERPE: Undecaprenyl-phosphate alpha-N-acetylglucosaminyl 1-phosphate transferase (wecA) from Yersinia pestis
KEGG orthology group: K02851, undecaprenyl-phosphate alpha-N-acetylglucosaminyltransferase [EC: 2.7.8.-] (inferred from 95% identity to ddd:Dda3937_00268)MetaCyc: 64% identical to UDP-N-acetylglucosamine--undecaprenyl-phosphate N-acetylglucosaminephosphotransferase (Escherichia coli O157)
GLCNACPTRANS-RXN [EC: 2.7.8.33]
Predicted SEED Role
"Undecaprenyl-phosphate N-acetylglucosaminyl 1-phosphate transferase (EC 2.7.8.-)" in subsystem Methicillin resistance in Staphylococci or Teichoic and lipoteichoic acids biosynthesis (EC 2.7.8.-)
MetaCyc Pathways
- superpathway of enterobacterial common antigen biosynthesis (8/10 steps found)
- enterobacterial common antigen biosynthesis (3/5 steps found)
- Escherichia coli serotype O:15 O antigen biosynthesis (1/5 steps found)
- Salmonella enterica serotype O:54 O antigen biosynthesis (1/5 steps found)
- Escherichia coli serotype O:149/Shigella boydii serotype O1 O antigen biosynthesis (1/6 steps found)
- Escherichia coli serotype O:177 O antigen biosynthesis (1/6 steps found)
- Escherichia coli serotype O:50 O antigen biosynthesis (1/6 steps found)
- Escherichia coli serotype O:56 O antigen biosynthesis (1/6 steps found)
- Escherichia coli serotype O:77/Salmonella enterica serotype O:6,14 O antigen biosynthesis (1/6 steps found)
- Salmonella enterica serotype O:13 O antigen biosynthesis (1/6 steps found)
- Escherichia coli serotype O:111/Salmonella enterica serotype O:35 O antigen biosynthesis (1/7 steps found)
- Escherichia coli serotype O:152 O antigen biosynthesis (1/7 steps found)
- Escherichia coli serotype O:157/Salmonella enterica serotype O:30 O antigen biosynthesis (1/7 steps found)
- Escherichia coli serotype O:1B/Salmonella enterica serotype O:42 O antigen biosynthesis (1/7 steps found)
- Escherichia coli serotype O:2 O antigen biosynthesis (1/7 steps found)
- Escherichia coli serotype O:7 O antigen biosynthesis (1/7 steps found)
- Escherichia coli serotype O:71/Salmonella enterica serotype O:28ac O antigen biosynthesis (1/7 steps found)
- Escherichia coli serotype O:85/Salmonella enterica serotype O:17 O antigen biosynthesis (1/7 steps found)
- Salmonella enterica serotype O:18 O antigen biosynthesis (1/7 steps found)
- Salmonella enterica serotype O:39 O antigen biosynthesis (1/7 steps found)
- Salmonella enterica serotype O:6,7 O antigen biosynthesis (1/7 steps found)
- Escherichia coli serotype O:183/Shigella boydii serotype O:10 O antigen biosynthesis (2/9 steps found)
- Escherichia coli serotype O:104 O antigen biosynthesis (1/8 steps found)
- Escherichia coli serotype O:107 O antigen biosynthesis (1/8 steps found)
- Escherichia coli serotype O:117 O antigen biosynthesis (1/8 steps found)
- Escherichia coli serotype O:127 O antigen biosynthesis (1/8 steps found)
- Escherichia coli serotype O:128 O antigen biosynthesis (1/8 steps found)
- Escherichia coli serotype O:21/Salmonella enterica serotype O:38 O antigen biosynthesis (1/8 steps found)
- Escherichia coli serotype O:49 O antigen biosynthesis (1/8 steps found)
- Escherichia coli serotype O:51/Salmonella enterica serotype O:57 O antigen biosynthesis (1/8 steps found)
- Escherichia coli serotype O:52 O antigen biosynthesis (1/8 steps found)
- Escherichia coli serotype O:55/Salmonella enterica serotype O:50 O antigen biosynthesis (1/8 steps found)
- Escherichia coli serotype O:86 O antigen biosynthesis (1/8 steps found)
- Shigella boydii serotype 6 O antigen biosynthesis (1/8 steps found)
- Escherichia coli serotype O:169 O antigen biosynthesis (1/9 steps found)
- Escherichia coli serotype O:8 O antigen biosynthesis (1/9 steps found)
- Escherichia coli serotype O:9 O antigen biosynthesis (1/10 steps found)
- Escherichia coli serotype O:9a O antigen biosynthesis (1/10 steps found)
- poly(3-O-β-D-glucopyranosyl-N-acetylgalactosamine 1-phosphate) wall teichoic acid biosynthesis (1/10 steps found)
- poly(glycerol phosphate) wall teichoic acid biosynthesis (1/11 steps found)
- poly(ribitol phosphate) wall teichoic acid biosynthesis I (B. subtilis) (1/12 steps found)
- poly(ribitol phosphate) wall teichoic acid biosynthesis II (S. aureus) (1/14 steps found)
- H. pylori 26695 O-antigen biosynthesis (1/21 steps found)
KEGG Metabolic Maps
- Aminophosphonate metabolism
- Glycerophospholipid metabolism
- High-mannose type N-glycan biosynthesis
- Nucleotide sugars metabolism
- Sphingolipid metabolism
Isozymes
Compare fitness of predicted isozymes for: 2.7.8.-
Use Curated BLAST to search for 2.7.8.- or 2.7.8.33
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A0A3A4C854 at UniProt or InterPro
Protein Sequence (358 amino acids)
>DZA65_RS21255 UDP-N-acetylglucosamine--undecaprenyl-phosphate N-acetylglucosaminephosphotransferase (Dickeya dianthicola ME23) MMSAQLVAVFLCSFFSLLLARNVARKTGLVDRPNYRKRHHGAVPLVGGISVYIGVCLLLV LISEPIPHFPMYLMCSGVLVLIGALDDRFDISIGVRAAVQAAVAILMMALAGLVLQRLGY ILGPLWDIGLGPMRYLMTLFVVWTAINAFNMVDGIDGLLGGLSCVLFAGLGILLYHHGSL ALALWSFAMIAAILPYILLNLELMGRRYKVFMGDAGSTMIGFTAIWLLLQSSQGSDSAIR PVAALWVIAIPLMDMVAIVYRRLHKGTGLFSPDRQHIHHLLMRAGLTSRQACLLITLAAA LLAAVGIAGELLAVPEYVMLALFLLVFGGYGYCIKRAWRVARVVRRIQRYWRGHRYCE