Protein Info for DZA65_RS21255 in Dickeya dianthicola ME23

Annotation: UDP-N-acetylglucosamine--undecaprenyl-phosphate N-acetylglucosaminephosphotransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 358 transmembrane" amino acids 6 to 24 (19 residues), see Phobius details amino acids 44 to 63 (20 residues), see Phobius details amino acids 69 to 85 (17 residues), see Phobius details amino acids 97 to 118 (22 residues), see Phobius details amino acids 133 to 150 (18 residues), see Phobius details amino acids 157 to 176 (20 residues), see Phobius details amino acids 182 to 199 (18 residues), see Phobius details amino acids 211 to 229 (19 residues), see Phobius details amino acids 241 to 260 (20 residues), see Phobius details amino acids 291 to 311 (21 residues), see Phobius details amino acids 317 to 335 (19 residues), see Phobius details TIGR02380: undecaprenyl-phosphate alpha-N-acetylglucosaminyl 1-phosphatetransferase" amino acids 5 to 346 (342 residues), 483 bits, see alignment E=2.6e-149 PF00953: Glycos_transf_4" amino acids 71 to 230 (160 residues), 100.4 bits, see alignment E=5.4e-33

Best Hits

Swiss-Prot: 68% identical to WECA_YERPE: Undecaprenyl-phosphate alpha-N-acetylglucosaminyl 1-phosphate transferase (wecA) from Yersinia pestis

KEGG orthology group: K02851, undecaprenyl-phosphate alpha-N-acetylglucosaminyltransferase [EC: 2.7.8.-] (inferred from 95% identity to ddd:Dda3937_00268)

MetaCyc: 64% identical to UDP-N-acetylglucosamine--undecaprenyl-phosphate N-acetylglucosaminephosphotransferase (Escherichia coli O157)
GLCNACPTRANS-RXN [EC: 2.7.8.33]

Predicted SEED Role

"Undecaprenyl-phosphate N-acetylglucosaminyl 1-phosphate transferase (EC 2.7.8.-)" in subsystem Methicillin resistance in Staphylococci or Teichoic and lipoteichoic acids biosynthesis (EC 2.7.8.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.8.-

Use Curated BLAST to search for 2.7.8.- or 2.7.8.33

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4C854 at UniProt or InterPro

Protein Sequence (358 amino acids)

>DZA65_RS21255 UDP-N-acetylglucosamine--undecaprenyl-phosphate N-acetylglucosaminephosphotransferase (Dickeya dianthicola ME23)
MMSAQLVAVFLCSFFSLLLARNVARKTGLVDRPNYRKRHHGAVPLVGGISVYIGVCLLLV
LISEPIPHFPMYLMCSGVLVLIGALDDRFDISIGVRAAVQAAVAILMMALAGLVLQRLGY
ILGPLWDIGLGPMRYLMTLFVVWTAINAFNMVDGIDGLLGGLSCVLFAGLGILLYHHGSL
ALALWSFAMIAAILPYILLNLELMGRRYKVFMGDAGSTMIGFTAIWLLLQSSQGSDSAIR
PVAALWVIAIPLMDMVAIVYRRLHKGTGLFSPDRQHIHHLLMRAGLTSRQACLLITLAAA
LLAAVGIAGELLAVPEYVMLALFLLVFGGYGYCIKRAWRVARVVRRIQRYWRGHRYCE