Protein Info for DZA65_RS21245 in Dickeya dianthicola ME23

Annotation: UDP-N-acetylglucosamine 2-epimerase (non-hydrolyzing)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 72% identical to WECB_ECOLI: UDP-N-acetylglucosamine 2-epimerase (wecB) from Escherichia coli (strain K12)

KEGG orthology group: K01791, UDP-N-acetylglucosamine 2-epimerase [EC: 5.1.3.14] (inferred from 97% identity to ddd:Dda3937_00270)

MetaCyc: 72% identical to UDP-N-acetylglucosamine 2-epimerase (Escherichia coli K-12 substr. MG1655)
UDP-N-acetylglucosamine 2-epimerase. [EC: 5.1.3.14]

Predicted SEED Role

"UDP-N-acetylglucosamine 2-epimerase (EC 5.1.3.14)" in subsystem CMP-N-acetylneuraminate Biosynthesis or Sialic Acid Metabolism (EC 5.1.3.14)

MetaCyc Pathways

UDP-N-acetyl-α-D-mannosamine biosynthesis (1/1 steps found)
CMP-N-acetylneuraminate biosynthesis II (bacteria) (1/3 steps found)
CMP-N-acetylneuraminate biosynthesis I (eukaryotes) (1/5 steps found)
superpathway of CMP-sialic acids biosynthesis (2/15 steps found)
superpathway of UDP-N-acetylglucosamine-derived O-antigen building blocks biosynthesis (8/24 steps found)

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.1.3.14

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4CJK1 at UniProt or InterPro

Protein Sequence (376 amino acids)

>DZA65_RS21245 UDP-N-acetylglucosamine 2-epimerase (non-hydrolyzing) (Dickeya dianthicola ME23)
MKVLTVFGTRPEAIKMAPVIRAMAQDAFFESKVCVTAQHRDMLDQVLRLFEIVPDYDLNV
MQPDQGLVEISARILSGLGPVLTRFQPDLMLVHGDTTTTLMTSLAAFYHRIPVAHVEAGL
RTGNLTSPWPEEANRMLTGRLATYHFAPTITARQNLRREQVPPSRIWVTGNSVIDALFWV
RDLIARDAVLRDQLQEKYAFLEPERKMILVTSHRRESFGEGMERICHALAAVARHHPDIQ
MVYPVHRNPNVLEPVQRILSGIDNVFLITPQDYLPFVYLMNRAWLILTDSGGIQEEAPSL
GKPVLVMRETTERPEALAAGTVRLVGTDTATIIREVSQLLADAAAYQAMSYAHNPYGDGL
ASQRILSVLKQHRVTA