Protein Info for DZA65_RS21240 in Dickeya dianthicola ME23

Annotation: UDP-N-acetyl-D-mannosamine dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 421 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details TIGR03026: nucleotide sugar dehydrogenase" amino acids 5 to 417 (413 residues), 370 bits, see alignment E=6.9e-115 PF03721: UDPG_MGDP_dh_N" amino acids 5 to 189 (185 residues), 159.8 bits, see alignment E=1.2e-50 PF00984: UDPG_MGDP_dh" amino acids 207 to 294 (88 residues), 94.8 bits, see alignment E=5.4e-31 PF03720: UDPG_MGDP_dh_C" amino acids 325 to 420 (96 residues), 67.1 bits, see alignment E=3.1e-22

Best Hits

Swiss-Prot: 70% identical to WECC_SALTI: UDP-N-acetyl-D-mannosamine dehydrogenase (wecC) from Salmonella typhi

KEGG orthology group: K02472, UDP-N-acetyl-D-mannosaminuronic acid dehydrogenase [EC: 1.1.1.-] (inferred from 92% identity to ddd:Dda3937_00271)

MetaCyc: 69% identical to UDP-N-acetyl-D-mannosamine dehydrogenase (Escherichia coli K-12 substr. MG1655)
UDPMANNACADEHYDROG-RXN [EC: 1.1.1.336]

Predicted SEED Role

"UDP-N-acetyl-D-mannosamine dehydrogenase (EC 1.1.1.-)" (EC 1.1.1.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.-

Use Curated BLAST to search for 1.1.1.- or 1.1.1.336

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4CQE6 at UniProt or InterPro

Protein Sequence (421 amino acids)

>DZA65_RS21240 UDP-N-acetyl-D-mannosamine dehydrogenase (Dickeya dianthicola ME23)
MSFNRICVLGLGYIGLPTATLLASRQLPVFGVDVNPHVVESINRGHTHIAEPGLAQAVQA
VVAQGYLQAGSQPVSAQAFLIAVPTPLKADHQPDVSFVEAAALSLAPVLKPGDLIILEST
SPVGTTERMAGWLAQVRPDLSFPQQAGEASDIRIAYCPERVLPGRIMEELLSHERVIGGM
TPRCSARASELYRLFLLEGDCTMTDSRTAEMCKLTENSFRDVNIAFANELSLICAEQQID
VWALIRLANRHPRVNILQPGPGVGGHCIAVDPWFIVAQHPQQARLIRTAREVNDAKPRWV
VEQVKIMVAEALAQGNKRACDLRIACLGLAFKPDVEDLRESPALAIAGQIAAWHAGTTWV
VEPHIRQLPPGLQEKAALVEMDRALSEADILVLLVDHRQFRAIAPEQVAQRWVVDTKGVW
R