Protein Info for DZA65_RS21225 in Dickeya dianthicola ME23
Annotation: lipid III flippase WzxE
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 62% identical to WZXE_SHIFL: Lipid III flippase (wzxE) from Shigella flexneri
KEGG orthology group: K03328, polysaccharide transporter, PST family (inferred from 95% identity to ddd:Dda3937_00274)MetaCyc: 62% identical to lipid IIIECA flippase (Escherichia coli K-12 substr. MG1655)
7.5.99.a [EC: 7.5.99.a]
Predicted SEED Role
"WzxE protein"
MetaCyc Pathways
- superpathway of enterobacterial common antigen biosynthesis (8/10 steps found)
- enterobacterial common antigen biosynthesis (3/5 steps found)
- Salmonella enterica serotype O:3,10 O antigen biosynthesis (2/5 steps found)
- Porphyromonas gingivalis O-LPS antigen biosynthesis (2/6 steps found)
- Salmonella enterica serotype O:2 O antigen biosynthesis (2/6 steps found)
- Salmonella enterica serotype O:4 O antigen biosynthesis (group B1) (2/6 steps found)
- Salmonella enterica serotype O:9 O antigen biosynthesis (2/6 steps found)
- Salmonella enterica serotype O:9,46 O antigen biosynthesis (2/6 steps found)
- Escherichia coli serotype O:15 O antigen biosynthesis (1/5 steps found)
- Escherichia coli serotype O:149/Shigella boydii serotype O1 O antigen biosynthesis (1/6 steps found)
- Escherichia coli serotype O:177 O antigen biosynthesis (1/6 steps found)
- Escherichia coli serotype O:50 O antigen biosynthesis (1/6 steps found)
- Escherichia coli serotype O:56 O antigen biosynthesis (1/6 steps found)
- Escherichia coli serotype O:77/Salmonella enterica serotype O:6,14 O antigen biosynthesis (1/6 steps found)
- Salmonella enterica serotype O:13 O antigen biosynthesis (1/6 steps found)
- Escherichia coli serotype O:111/Salmonella enterica serotype O:35 O antigen biosynthesis (1/7 steps found)
- Escherichia coli serotype O:152 O antigen biosynthesis (1/7 steps found)
- Escherichia coli serotype O:157/Salmonella enterica serotype O:30 O antigen biosynthesis (1/7 steps found)
- Escherichia coli serotype O:1B/Salmonella enterica serotype O:42 O antigen biosynthesis (1/7 steps found)
- Escherichia coli serotype O:2 O antigen biosynthesis (1/7 steps found)
- Escherichia coli serotype O:7 O antigen biosynthesis (1/7 steps found)
- Escherichia coli serotype O:71/Salmonella enterica serotype O:28ac O antigen biosynthesis (1/7 steps found)
- Escherichia coli serotype O:85/Salmonella enterica serotype O:17 O antigen biosynthesis (1/7 steps found)
- Salmonella enterica serotype O:18 O antigen biosynthesis (1/7 steps found)
- Salmonella enterica serotype O:39 O antigen biosynthesis (1/7 steps found)
- Salmonella enterica serotype O:6,7 O antigen biosynthesis (1/7 steps found)
- Escherichia coli serotype O:183/Shigella boydii serotype O:10 O antigen biosynthesis (2/9 steps found)
- Salmonella enterica serotype O:9,46,27 O antigen biosynthesis (2/9 steps found)
- Escherichia coli serotype O:104 O antigen biosynthesis (1/8 steps found)
- Escherichia coli serotype O:107 O antigen biosynthesis (1/8 steps found)
- Escherichia coli serotype O:117 O antigen biosynthesis (1/8 steps found)
- Escherichia coli serotype O:127 O antigen biosynthesis (1/8 steps found)
- Escherichia coli serotype O:128 O antigen biosynthesis (1/8 steps found)
- Escherichia coli serotype O:21/Salmonella enterica serotype O:38 O antigen biosynthesis (1/8 steps found)
- Escherichia coli serotype O:49 O antigen biosynthesis (1/8 steps found)
- Escherichia coli serotype O:51/Salmonella enterica serotype O:57 O antigen biosynthesis (1/8 steps found)
- Escherichia coli serotype O:55/Salmonella enterica serotype O:50 O antigen biosynthesis (1/8 steps found)
- Escherichia coli serotype O:86 O antigen biosynthesis (1/8 steps found)
- Salmonella enterica serotype O:8 O antigen biosynthesis (1/8 steps found)
- Shigella boydii serotype 6 O antigen biosynthesis (1/8 steps found)
- Escherichia coli serotype O:169 O antigen biosynthesis (1/9 steps found)
Isozymes
No predicted isozymesUse Curated BLAST to search for 7.5.99.a
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A0A385Y355 at UniProt or InterPro
Protein Sequence (416 amino acids)
>DZA65_RS21225 lipid III flippase WzxE (Dickeya dianthicola ME23) MSLARASLWTAASTLVKIGVGLVIIKLLAVTFGPEGVGLAGNYRQLITVLGVMAGAGIAN GVTRAVAAAPPDANRPGPLLGTAVSLSMGCSLLLTLALWLLAAPLSRLLFGDDAYQPAIR ALAWLQLGIAGASLLLAILKGYQDARGNALAVMAGSLLGAVAYGVSVWLGAYTGALVGLA LMPALVCVPALALLFRRTPLGLRALTPDWSWPLAGQLTRFSLMTLITAVTLPVGYVMMRK LLATHYTWQEVGVWQGVTIISDAWLQFITASFPVYLLPALARLQDKRAVRHEILSALRLV LPAAAAVGVAIWLLRDVAIRLLFSSEFSAMRDLFAWQLAGDVLKVGAYVFGYLVVARASL RFYLLAELGQFLLLTGFARWLIPLHGALGASQAYLATYAVYFLLCCGVFILYCRRA