Protein Info for DZA65_RS21215 in Dickeya dianthicola ME23

Annotation: O-antigen assembly polymerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 446 transmembrane" amino acids 6 to 24 (19 residues), see Phobius details amino acids 36 to 59 (24 residues), see Phobius details amino acids 69 to 89 (21 residues), see Phobius details amino acids 110 to 132 (23 residues), see Phobius details amino acids 152 to 174 (23 residues), see Phobius details amino acids 183 to 216 (34 residues), see Phobius details amino acids 222 to 244 (23 residues), see Phobius details amino acids 286 to 305 (20 residues), see Phobius details amino acids 335 to 360 (26 residues), see Phobius details amino acids 377 to 397 (21 residues), see Phobius details amino acids 404 to 429 (26 residues), see Phobius details PF06899: WzyE" amino acids 1 to 445 (445 residues), 840.9 bits, see alignment E=1.3e-257

Best Hits

Swiss-Prot: 72% identical to WZYE_PECAS: Probable ECA polymerase (wzyE) from Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)

KEGG orthology group: K02853, 4-alpha-L-fucosyltransferase [EC: 2.4.1.-] (inferred from 97% identity to ddd:Dda3937_00276)

Predicted SEED Role

"Putative ECA polymerase"

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.4.1.-

Use Curated BLAST to search for 2.4.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A385Y2U4 at UniProt or InterPro

Protein Sequence (446 amino acids)

>DZA65_RS21215 O-antigen assembly polymerase (Dickeya dianthicola ME23)
MTEWAFFGLWLVWLGGGGVVLWLSGREFRRWRFNFNVLFSLLYLLTFYFGFPLTALLTFR
FGVETASPLNLLLALLSATAFYVIYYVSYKTRLRPAPPVSRPLPLTMTRLEALLTGGLLA
LVALATAAVFFANNGLLLFKLSSYSQIFSRDVAGVALKRFFYFFIPAMLMWYFLHQTRRA
WLIFLLTTVAFGGLTYLLVGGTRANIIIAFALFLFIGLQRGWIVWWMLAAAGAGGIVAMF
WLALKRYGLDVKGEEAFYTFLYLTRDTFSPWENLAMLWQHLDQIRLQGLAPIVRDFYVFI
PAWLWPERPALVLNSANYFTWEVLNYHAGLAISPTLLGSLLIMGGPLLIPVGAVAVGLLI
KGFDGLYRYGRQAENRYLSAVLQAFCFGAVFNLIVLVREGLDAFVSRVVFFCLIFAACLL
AAKLLYWLLWRAGAVAARAPSQGETE