Protein Info for DZA65_RS21205 in Dickeya dianthicola ME23

Annotation: amino acid permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 464 transmembrane" amino acids 21 to 40 (20 residues), see Phobius details amino acids 46 to 62 (17 residues), see Phobius details amino acids 97 to 121 (25 residues), see Phobius details amino acids 127 to 148 (22 residues), see Phobius details amino acids 160 to 179 (20 residues), see Phobius details amino acids 200 to 222 (23 residues), see Phobius details amino acids 242 to 263 (22 residues), see Phobius details amino acids 276 to 301 (26 residues), see Phobius details amino acids 329 to 355 (27 residues), see Phobius details amino acids 361 to 382 (22 residues), see Phobius details amino acids 403 to 425 (23 residues), see Phobius details amino acids 431 to 451 (21 residues), see Phobius details PF00324: AA_permease" amino acids 18 to 430 (413 residues), 360.1 bits, see alignment E=1.7e-111 PF13520: AA_permease_2" amino acids 22 to 424 (403 residues), 120.2 bits, see alignment E=1.1e-38

Best Hits

Swiss-Prot: 81% identical to YIFK_SALTY: Probable transport protein YifK (yifK) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K03293, amino acid transporter, AAT family (inferred from 99% identity to ddd:Dda3937_00278)

MetaCyc: 80% identical to threonine/serine:H+ symporter ThrP (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-71; TRANS-RXN-72

Predicted SEED Role

"Probable transport protein YifK"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A385Y3W9 at UniProt or InterPro

Protein Sequence (464 amino acids)

>DZA65_RS21205 amino acid permease (Dickeya dianthicola ME23)
MANTEKQDKLHRGLEARHIELIALGGTIGVGLFMGAASALKWAGPSVLLAYIVAGIFVFF
IMRSMGEMLFLEPVTGSFAVYAHNYLSPFFGYLTAWGYWFMWMAVGISEITAIGVYVQYW
FPTLPQWIPAIGAVALVAAANLAAVRLYGEIEFWFSMIKITTIVVMIVVGVGIIFFGIGN
HGQATGFVNLTEHGGFLAGGWKGLLFALCLVVASYQGVELVGITAGEARNPQVTLKRAIN
NILWRILIFYVGAIFVIVTIFPWNEIGTSGSPFVLTFAKIGITAAAGIINFVVLTAALSG
CNSGMYSCGRMLYSLANNRQLPAALGRVTAGGVPAIGVMVSILCLVAGSVLNYLIPNPEK
VFVYVYSASVLPGMIPWFVVLISQLRFRQQHQAALAGHPFKSILFPWVNYLTMAFLLCVL
VGMYINEDTRMSLVVGGIFLAAVSLFYVALGLGKKQPEMQTETE