Protein Info for DZA65_RS21160 in Dickeya dianthicola ME23

Annotation: GNAT family N-acetyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF13673: Acetyltransf_10
  • amino acids 33 to 160 (128 residues), 35.9 bits, E=1.1e-12
• PF00583: Acetyltransf_1
  • amino acids 42 to 140 (99 residues), 38 bits, E=2.8e-13
• PF13508: Acetyltransf_7
  • amino acids 50 to 141 (92 residues), 33.8 bits, E=5.6e-12

Best Hits

Swiss-Prot: 47% identical to YXEL_BACSU: Uncharacterized N-acetyltransferase YxeL (yxeL) from Bacillus subtilis (strain 168)

KEGG orthology group: None (inferred from 96% identity to dda:Dd703_0216)

MetaCyc: 47% identical to S-(2-succino)cysteine N-acetyltransferase (Bacillus subtilis subtilis 168)
2.3.1.M101 [EC: 2.3.1.M101]

Predicted SEED Role

"FIG01201438: hypothetical protein"

MetaCyc Pathways

• S-(2-succinyl)-L-cysteine degradation (3/4 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.3.1.M101

Sequence Analysis Tools

See A0A385Y5C4 at UniProt or InterPro

Protein Sequence (178 amino acids)

>DZA65_RS21160 GNAT family N-acetyltransferase (Dickeya dianthicola ME23)
MSTVFRQVTLADDDAFLELALAAYAPVREMGIKFDAAYADIERIRFHIQNNGVYVMEKEG
RFASSCSIRYPWGPEPGPFGLPHIGWFATHPDFKQQGLGRQMLDWLEQQVLLEQLKAPAV
SLGTAKNHPWLLEMYRNYGFRDVCQADLGKGHLTIFMEKVLDPQRYDQWKKIHPSAEI