Protein Info for DZA65_RS21145 in Dickeya dianthicola ME23

Annotation: amino acid ABC transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 253 PF00005: ABC_tran" amino acids 17 to 168 (152 residues), 126 bits, see alignment E=2.5e-40 PF02463: SMC_N" amino acids 28 to 209 (182 residues), 43.1 bits, see alignment E=5.1e-15

Best Hits

Swiss-Prot: 65% identical to YXEO_BACSU: Probable amino-acid import ATP-binding protein YxeO (yxeO) from Bacillus subtilis (strain 168)

KEGG orthology group: None (inferred from 97% identity to ddd:Dda3937_00288)

MetaCyc: 56% identical to cystine ABC transporter ATP binding subunit (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-290 [EC: 7.4.2.12]; 7.4.2.12 [EC: 7.4.2.12]; 7.4.2.- [EC: 7.4.2.12]; 7.4.2.- [EC: 7.4.2.12]; 7.4.2.- [EC: 7.4.2.12]; 7.4.2.- [EC: 7.4.2.12]

Predicted SEED Role

"ABC-type polar amino acid transport system, ATPase component"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.4.2.12

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A385Y2T0 at UniProt or InterPro

Protein Sequence (253 amino acids)

>DZA65_RS21145 amino acid ABC transporter ATP-binding protein (Dickeya dianthicola ME23)
MISVKNLTKRFGDQVVLNNISLDIDEGEVVAIIGPSGSGKSTLLRCLNLLEKPESGTITI
GEQSLDTHRYTGKEAYALRRQTAMVFQNYNLFKNKTALENITEALIVVKKMPKKQANEIG
QELLELVGLLPQAHQYPVTLSGGQQQRVGIARALAVDPKAVLFDEPTSALDPERVHEVLQ
VIQKLAGQNTTMVIVTHEMQFAKEVADRVIFMADGHIVEQGPAEKVISFSDNPQTRRFLR
QLTNIQEPSEFDI