Protein Info for DZA65_RS21100 in Dickeya dianthicola ME23

Annotation: diaminopimelate epimerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00652: diaminopimelate epimerase
  • amino acids 1 to 273 (273 residues), 340 bits, E=5.1e-106
• PF01678: DAP_epimerase
  • amino acids 3 to 123 (121 residues), 115.1 bits, E=1e-37
  • amino acids 152 to 267 (116 residues), 126.5 bits, E=3.1e-41

Best Hits

Swiss-Prot: 88% identical to DAPF_PECCP: Diaminopimelate epimerase (dapF) from Pectobacterium carotovorum subsp. carotovorum (strain PC1)

KEGG orthology group: K01778, diaminopimelate epimerase [EC: 5.1.1.7] (inferred from 97% identity to ddd:Dda3937_00297)

MetaCyc: 86% identical to diaminopimelate epimerase (Escherichia coli K-12 substr. MG1655)
Diaminopimelate epimerase. [EC: 5.1.1.7]

Predicted SEED Role

"Diaminopimelate epimerase (EC 5.1.1.7)" in subsystem Lysine Biosynthesis DAP Pathway (EC 5.1.1.7)

MetaCyc Pathways

• aspartate superpathway (24/25 steps found)
• superpathway of L-lysine, L-threonine and L-methionine biosynthesis I (18/18 steps found)
• L-lysine biosynthesis I (9/9 steps found)
• superpathway of L-lysine, L-threonine and L-methionine biosynthesis II (13/15 steps found)
• L-lysine biosynthesis VI (6/7 steps found)
• L-lysine biosynthesis II (7/9 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Lysine biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.1.1.7

Sequence Analysis Tools

See A0A3A4D6F9 at UniProt or InterPro

Protein Sequence (274 amino acids)

>DZA65_RS21100 diaminopimelate epimerase (Dickeya dianthicola ME23)
MQFSKMHGLGNDFMVVDAVTQNVYFSPELIRRLSDRHCGVGFDQLLIVEPPYDPELDFHY
RIFNADGSEVAQCGNGARCFARFVRLKGLTSKREINVSTHNGRMVLSVTEDELVRVNMGE
PNFEPQQVPFRAAKPEKTYILRVAEHTVLCGAVSMGNPHCVIQVDDVDTAPVETLGPLLE
SHERFPERVNIGFMQVVNAGLIRLRVFERGAGETQACGSGACAAVAVGIQQGLLAADVKV
QLPGGELEIHWDGPGHPLFMTGPATHVYDGFMHL