Protein Info for DZA65_RS21075 in Dickeya dianthicola ME23

Annotation: magnesium/cobalt transporter CorA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 316 transmembrane" amino acids 255 to 277 (23 residues), see Phobius details amino acids 290 to 310 (21 residues), see Phobius details TIGR00383: magnesium and cobalt transport protein CorA" amino acids 4 to 316 (313 residues), 355.2 bits, see alignment E=1.8e-110 PF01544: CorA" amino acids 27 to 312 (286 residues), 179.7 bits, see alignment E=4.3e-57

Best Hits

Swiss-Prot: 91% identical to CORA_PECAS: Magnesium transport protein CorA (corA) from Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)

KEGG orthology group: K03284, metal ion transporter, MIT family (inferred from 99% identity to ddd:Dda3937_00303)

MetaCyc: 87% identical to Ni2+/Co2+/Mg2+ transporter (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-141; TRANS-RXN-141A; TRANS-RXN-141B

Predicted SEED Role

"Magnesium and cobalt transport protein CorA" in subsystem Campylobacter Iron Metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A385Y2P9 at UniProt or InterPro

Protein Sequence (316 amino acids)

>DZA65_RS21075 magnesium/cobalt transporter CorA (Dickeya dianthicola ME23)
MLSAFKLDNCRLTRLELDESNDLTTSLWVDLVEPDIEERDLVQNQLGQSLATRPELEDIE
ASARFFEDEDGLHIHSFFFYEDADDHAGNSTVAFTIRDGRLYTLRERELPAFRLYRMRAR
AQTLVDGNAYELLLDLFETKIEQLADEIENIYSDLESLSRVIMDGRQGDEYDDALSTLAE
QEDIGWKVRLCLMDTQRALNFLVRRARLPSSQLEQAREILRDIESLLPHNESLFQKVNFL
MQAAMGFINIEQNRIIKIFSVVSVVFLPPTLVASSYGMNFEFMPELKWAYGYPGAMLLML
LAGLAPYLYFKRRNWL