Protein Info for DZA65_RS21045 in Dickeya dianthicola ME23

Annotation: ATP-dependent DNA helicase RecQ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 609 TIGR01389: ATP-dependent DNA helicase RecQ" amino acids 14 to 602 (589 residues), 877.4 bits, see alignment E=4.7e-268 TIGR00614: ATP-dependent DNA helicase, RecQ family" amino acids 15 to 464 (450 residues), 648.8 bits, see alignment E=4.9e-199 PF04851: ResIII" amino acids 26 to 184 (159 residues), 30.1 bits, see alignment E=1.3e-10 PF00270: DEAD" amino acids 27 to 188 (162 residues), 95.5 bits, see alignment E=9.2e-31 PF00271: Helicase_C" amino acids 220 to 331 (112 residues), 76.7 bits, see alignment E=4.9e-25 PF16124: RecQ_Zn_bind" amino acids 342 to 404 (63 residues), 60.2 bits, see alignment E=8.2e-20 PF09382: RQC" amino acids 406 to 514 (109 residues), 135.2 bits, see alignment E=2.7e-43 PF00570: HRDC" amino acids 534 to 600 (67 residues), 82.2 bits, see alignment E=6.3e-27

Best Hits

Swiss-Prot: 78% identical to RECQ_ECOLI: ATP-dependent DNA helicase RecQ (recQ) from Escherichia coli (strain K12)

KEGG orthology group: K03654, ATP-dependent DNA helicase RecQ [EC: 3.6.4.12] (inferred from 98% identity to ddd:Dda3937_00308)

MetaCyc: 78% identical to ATP-dependent DNA helicase RecQ (Escherichia coli K-12 substr. MG1655)
RXN-11135 [EC: 5.6.2.4]

Predicted SEED Role

"ATP-dependent DNA helicase RecQ" in subsystem DNA-replication or DNA repair, bacterial RecFOR pathway

Isozymes

Compare fitness of predicted isozymes for: 3.6.4.12

Use Curated BLAST to search for 3.6.4.12 or 5.6.2.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A385Y2M8 at UniProt or InterPro

Protein Sequence (609 amino acids)

>DZA65_RS21045 ATP-dependent DNA helicase RecQ (Dickeya dianthicola ME23)
MSTADVLNKETLAMQVLRETFGYQQFRPGQQAIINAAISGRDCLVIMPTGGGKSLCYQIP
ALVLEGLTLVVSPLISLMKDQVDQLQAYGVAAACLNSTQTREQQQAVFSACRRGELKLLY
IAPERLTTDGFLEQLTHWNTTLIAIDEAHCISQWGHDFRPEYRALGQIKQQFPALPIVAL
TATADETTRQDIARLLDLRDPLTNISSFDRPNIRYTLVEKFKPLDQLWLFVQGQRGKSGI
VYCNSRAKVEDLCARLQNRGLSVGAYHAGLENDRRAQVQEAFLRDDLQVVVATVAFGMGI
NKPNVRFVVHFDIPRNIESYYQETGRAGRDGLPAEAALFYDPADMAWLRRCLEEKPAGVQ
LDIERHKLNAMGAFAEAQTCRRLVLLNYFGENRQQACGNCDVCLDPPRRYDGLVDAQKAL
SCVYRVGQRFGIGYIAEVLRGANNQRIREFGHDKLPVYGLGKDKTQEQWVSILRQLIHLG
LLAQNIAHHSALQLTESARPVLRGEAPLQLAVPRVISLSKPRAGQKTYGGNYDRKLFAKL
RKLRKSIADEDNIPPYVVFSDATLLEMAELLPVTASELLAVNGVGQRKLERFGAPFMTLI
RDHLDSGDD