Protein Info for DZA65_RS21040 in Dickeya dianthicola ME23
Annotation: threonine export protein RhtC
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 73% identical to RHTC_ECOLI: Threonine efflux protein (rhtC) from Escherichia coli (strain K12)
KEGG orthology group: K05835, threonine efflux protein (inferred from 96% identity to dze:Dd1591_0194)MetaCyc: 73% identical to L-threonine exporter (Escherichia coli K-12 substr. MG1655)
TRANS-RXN0-0244
Predicted SEED Role
"L-lysine permease" in subsystem Lysine degradation
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A0A3A4D6G9 at UniProt or InterPro
Protein Sequence (207 amino acids)
>DZA65_RS21040 threonine export protein RhtC (Dickeya dianthicola ME23) MLMLFLTVALVHWIALMSPGPDFFFVSQTAISRSRREALMGVLGITLGVLVWAAIALMGL HLLLERMAWLHRLVTIGGGLYLCWMGWQLLRSALRKRAHQGEETVEAALPQQGKTFMRGL LTNLSNPKALIYFGSVFSLFVGDDVGAAARWGLFALISLETLLWFSLVALVFALPVMRRG YQRLAKWVDGLAGALFTGFGIHLIISR