Protein Info for DZA65_RS21025 in Dickeya dianthicola ME23

Annotation: sugar/pyridoxal phosphate phosphatase YigL

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 269 TIGR00099: Cof-like hydrolase" amino acids 4 to 260 (257 residues), 215.1 bits, see alignment E=1.3e-67 TIGR01484: HAD hydrolase, family IIB" amino acids 4 to 231 (228 residues), 86 bits, see alignment E=3.9e-28 PF05116: S6PP" amino acids 4 to 78 (75 residues), 27.1 bits, see alignment E=4.6e-10 amino acids 159 to 241 (83 residues), 28 bits, see alignment E=2.5e-10 PF08282: Hydrolase_3" amino acids 5 to 259 (255 residues), 196.1 bits, see alignment E=1.4e-61

Best Hits

Swiss-Prot: 75% identical to YIGL_ECOLI: Pyridoxal phosphate phosphatase YigL (yigL) from Escherichia coli (strain K12)

KEGG orthology group: K07024, (no description) (inferred from 95% identity to ddc:Dd586_3858)

MetaCyc: 75% identical to phosphosugar phosphatase YigL (Escherichia coli K-12 substr. MG1655)
Pyridoxal phosphatase. [EC: 3.1.3.74]; Sugar-phosphatase. [EC: 3.1.3.74, 3.1.3.23]

Predicted SEED Role

"HMP-PP hydrolase (pyridoxal phosphatase) Cof, detected in genetic screen for thiamin metabolic genes (PMID:15292217)"

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.3.23 or 3.1.3.74

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A385Y3A9 at UniProt or InterPro

Protein Sequence (269 amino acids)

>DZA65_RS21025 sugar/pyridoxal phosphate phosphatase YigL (Dickeya dianthicola ME23)
MYPIVASDLDGTLLSPDHTLSPYAKETLRLMTEQGVHFVFATGRHHMDVAQIRDNLAISA
YMITSNGARVHNTDGELIFSHNLDRDIAHDLFGMVYHHPEIMTHVYRGDEWFLCRSRPEE
ERFFTETVFRYKLFDPETLGTDGVGKVFFTCEDHDKLLPLEEALNARWGDRVNVSFSTLS
CLEVMAGGVSKGHALEQVAKILGHTIKDCIAFGDGMNDYEMLSMAGKGCIMSNAHQRLKD
MLPDNEVIGANIEQAVPKYLRRLYSGDDD