Protein Info for DZA65_RS21015 in Dickeya dianthicola ME23

Annotation: anaerobic glycerol-3-phosphate dehydrogenase subunit A

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01494: FAD_binding_3
  • amino acids 9 to 215 (207 residues), 22 bits, E=2.7e-08
• PF01266: DAO
  • amino acids 11 to 360 (350 residues), 197.2 bits, E=1.8e-61
• TIGR03377: glycerol-3-phosphate dehydrogenase, anaerobic, A subunit
  • amino acids 11 to 539 (529 residues), 862.2 bits, E=6.9e-264
• PF13450: NAD_binding_8
  • amino acids 14 to 52 (39 residues), 22.1 bits, 4.5e-08
• PF04324: Fer2_BFD
  • amino acids 433 to 482 (50 residues), 32.5 bits, 2.6e-11

Best Hits

Swiss-Prot: 69% identical to GLPA_HAEIN: Anaerobic glycerol-3-phosphate dehydrogenase subunit A (glpA) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: K00111, glycerol-3-phosphate dehydrogenase [EC: 1.1.5.3] (inferred from 97% identity to ddd:Dda3937_00317)

Predicted SEED Role

No annotation

MetaCyc Pathways

• glycerol and glycerophosphodiester degradation (4/4 steps found)
• glycerol degradation I (3/3 steps found)
• glycerol-3-phosphate shuttle (2/2 steps found)
• glycerol-3-phosphate to fumarate electron transfer (2/2 steps found)
• glycerophosphodiester degradation (2/2 steps found)
• nitrate reduction IX (dissimilatory) (2/2 steps found)
• glycerol 3-phosphate to cytochrome aa₃ oxidase electron transfer (1/2 steps found)
• glycerol-3-phosphate to cytochrome bo oxidase electron transfer (1/2 steps found)
• glycerol-3-phosphate to hydrogen peroxide electron transport (1/2 steps found)
• sn-glycerol 3-phosphate anaerobic respiration (1/3 steps found)

KEGG Metabolic Maps

• Glycerophospholipid metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.1.5.3

Use Curated BLAST to search for 1.1.5.3

Sequence Analysis Tools

See A0A385Y2J2 at UniProt or InterPro

Protein Sequence (547 amino acids)

>DZA65_RS21015 anaerobic glycerol-3-phosphate dehydrogenase subunit A (Dickeya dianthicola ME23)
MANNGLRRETDVVIIGGGATGAGTARDCALRGLRCLLLERHDIATGATGRNHGLLHSGAR
YAVTDAESARECIEENQILRRIARHCIEPTDGLFLTLPQDDLNYQARFVVACRQAGIPAQ
AIDPQEALQLEPAANPALIGAVKVPDGTVDPFRLTAANMIDACEHGAEVLTYHEVIGLIR
QGDRVTGVRVFDHKRRLASEIYAQVVVNAGGIWGQRIAEYADLTVRMFPAKGALLILGHR
INNRVINRCRKPADADILVPGDTISLIGTTSTRIDYDQIDHMTVTPAEVDTLIREGSLLA
PQLAQTRILRAYAGVRPLVASDNDPSGRSVSRGIVLLDHASRDGLEGFVTITGGKLMTYR
LMAEWVTDKVCEKLGHRADCATASRPLPGSEVSDPDRPQAASPLSAPLRGSAIYRHGHRA
APLVSGQRVDSSLVCECEAVTAGEVRYAVESLQVNNLTDLRRRTRVGMGTCQGELCACRA
AGLLCRLGQSTPQQAVSQLSQFLNERWKGMRPIAWGNTLRESEFTSWIYQGLCGLTESRE
QENSDAL