Protein Info for DZA65_RS20875 in Dickeya dianthicola ME23

Annotation: Fe-S biogenesis protein NfuA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 191 PF01521: Fe-S_biosyn" amino acids 2 to 99 (98 residues), 52.1 bits, see alignment E=7.4e-18 TIGR03341: IscR-regulated protein YhgI" amino acids 2 to 191 (190 residues), 335.7 bits, see alignment E=4e-105 PF01106: NifU" amino acids 111 to 177 (67 residues), 69 bits, see alignment E=3.1e-23

Best Hits

Swiss-Prot: 93% identical to NFUA_PECCP: Fe/S biogenesis protein NfuA (nfuA) from Pectobacterium carotovorum subsp. carotovorum (strain PC1)

KEGG orthology group: K07400, Fe/S biogenesis protein NfuA (inferred from 97% identity to ddc:Dd586_3826)

MetaCyc: 89% identical to iron-sulfur cluster carrier protein NfuA (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"NfuA Fe-S protein maturation"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4CKN9 at UniProt or InterPro

Protein Sequence (191 amino acids)

>DZA65_RS20875 Fe-S biogenesis protein NfuA (Dickeya dianthicola ME23)
MIRITDAAQEHFAKLLTKQEEGTQIRVFVINPGTPNAECGVSYCPPDAVEPNDTELKFEK
LSAYVDELSTPYLEDAEIDFVTDQLGSQLTLKAPNAKMRKVGDDAPLMERVEYVLQSQIN
PQLAGHGGRVTLMEITEESFAILQFGGGCNGCSMVDYTLKEGIEKELLQKFPELKGVRDL
TEHQRGEHSYY