Protein Info for DZA65_RS20870 in Dickeya dianthicola ME23

Annotation: DNA utilization protein GntX

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 239 PF18912: DZR_2" amino acids 7 to 55 (49 residues), 29.5 bits, see alignment 5.5e-11 PF00156: Pribosyltran" amino acids 179 to 236 (58 residues), 26.9 bits, see alignment E=2.8e-10

Best Hits

Swiss-Prot: 53% identical to GNTX_ECO57: DNA utilization protein YhgH (gntX) from Escherichia coli O157:H7

KEGG orthology group: None (inferred from 92% identity to ddd:Dda3937_00349)

Predicted SEED Role

"Competence protein F homolog, phosphoribosyltransferase domain; protein YhgH required for utilization of DNA as sole source of carbon and energy"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A385Y375 at UniProt or InterPro

Protein Sequence (239 amino acids)

>DZA65_RS20870 DNA utilization protein GntX (Dickeya dianthicola ME23)
MLTIMAQCWLCQQPLYHSHHGICSHCRRHLPLPVTCCPRCGLPSASDTLSCGRCLQQPPP
WQSLLFVSDYRPPLSTLLKRVKFQGRTELAPALARLMLLQWLARRRDTALSLPAAYPRPD
AIVTVPLHRRRHWRRGFNQTELLARLLARWLGCAYHPTALVRVRPTVPQQTLGARSRRRN
LRGAFECRHDVVNKQVVGKRLVLLDDVVTTGSTAAEVSRVLRQAGAQQVQVWCLCRTLS