Protein Info for DZA65_RS20810 in Dickeya dianthicola ME23

Annotation: GMP/IMP nucleotidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00702: Hydrolase
  • amino acids 10 to 186 (177 residues), 58.1 bits, E=1.6e-19
• TIGR01509: HAD hydrolase, family IA, variant 3
  • amino acids 13 to 191 (179 residues), 57.7 bits, E=7.9e-20
• PF13419: HAD_2
  • amino acids 13 to 190 (178 residues), 34.7 bits, E=1.9e-12

Best Hits

Swiss-Prot: 62% identical to YRFG_SHIFL: GMP/IMP nucleotidase YrfG (yrfG) from Shigella flexneri

KEGG orthology group: K07025, putative hydrolase of the HAD superfamily (inferred from 95% identity to ddd:Dda3937_00360)

MetaCyc: 62% identical to purine nucleotidase (Escherichia coli K-12 substr. MG1655)
5'-nucleotidase. [EC: 3.1.3.5, 3.1.3.99]; 3.1.3.5 [EC: 3.1.3.5, 3.1.3.99]

Predicted SEED Role

"FIG001957: putative hydrolase"

MetaCyc Pathways

• purine nucleotides degradation II (aerobic) (9/11 steps found)
• ureide biosynthesis (6/7 steps found)
• NAD salvage pathway III (to nicotinamide riboside) (3/3 steps found)
• guanosine nucleotides degradation II (3/4 steps found)
• guanosine nucleotides degradation III (3/4 steps found)
• inosine 5'-phosphate degradation (3/4 steps found)
• UTP and CTP dephosphorylation I (5/7 steps found)
• superpathway of guanosine nucleotides degradation (plants) (4/6 steps found)
• adenosine nucleotides degradation II (3/5 steps found)
• purine nucleotides degradation I (plants) (8/12 steps found)
• adenosine nucleotides degradation I (5/8 steps found)
• guanosine nucleotides degradation I (2/4 steps found)
• superpathway of purines degradation in plants (11/18 steps found)
• NAD salvage (plants) (5/11 steps found)
• tunicamycin biosynthesis (2/9 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Nicotinate and nicotinamide metabolism
• Purine metabolism
• Pyrimidine metabolism

Isozymes

Compare fitness of predicted isozymes for: 3.1.3.5

Use Curated BLAST to search for 3.1.3.5 or 3.1.3.99

Sequence Analysis Tools

See A0A385Y2J9 at UniProt or InterPro

Protein Sequence (234 amino acids)

>DZA65_RS20810 GMP/IMP nucleotidase (Dickeya dianthicola ME23)
MNPELNWNEIDTVLLDMDGTLLDLAFDSYFWLQLVPESLSRQRNISLDQAQQLITAEYQA
VRHTLNWYCFDYWSNRLGLDIYQMTSDIGHRARLRDDTTPFLHALRASGRRTILLTNAHP
HSLSVKVAHTGLDRHLDLLLSTHTYGYPKEDQRLWRSVQAETGFNPARTLFVDDSEPILD
AARTFGIRYCLGVSNPDSTCRQENRFQQHPSMNDYLALLPGIHQSVFVGNQEYS