Protein Info for DZA65_RS20785 in Dickeya dianthicola ME23

Annotation: PilN domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 186 transmembrane" amino acids 20 to 43 (24 residues), see Phobius details PF05137: PilN" amino acids 100 to 173 (74 residues), 40.8 bits, see alignment E=9.4e-15

Best Hits

KEGG orthology group: K12289, pilus assembly protein HofN (inferred from 94% identity to ddd:Dda3937_00075)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4C3Z5 at UniProt or InterPro

Protein Sequence (186 amino acids)

>DZA65_RS20785 PilN domain-containing protein (Dickeya dianthicola ME23)
MLTVNLLAWRQRLLYRRLRLSLLALGLSLFGIGCAAVMAGWYWQQQLTGLRQRLDQTQSQ
QSRYEQLYRQTRDAWQARENRLAQQAAQERGRRQNLRYQALLEQLPTLVPDSLWLTEIGD
NGAHLQISGVSNHYSAIVTLAKAMATLPQIEHASVQQTQRDAQDSTRLSFSLRLYWQALA
ETGAKG