Protein Info for DZA65_RS20685 in Dickeya dianthicola ME23

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 380 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details transmembrane" amino acids 38 to 56 (19 residues), see Phobius details amino acids 68 to 89 (22 residues), see Phobius details amino acids 95 to 116 (22 residues), see Phobius details amino acids 127 to 147 (21 residues), see Phobius details amino acids 159 to 178 (20 residues), see Phobius details amino acids 199 to 220 (22 residues), see Phobius details amino acids 234 to 254 (21 residues), see Phobius details amino acids 261 to 283 (23 residues), see Phobius details amino acids 289 to 310 (22 residues), see Phobius details amino acids 324 to 345 (22 residues), see Phobius details amino acids 352 to 373 (22 residues), see Phobius details PF07690: MFS_1" amino acids 12 to 337 (326 residues), 85.8 bits, see alignment E=1.5e-28

Best Hits

KEGG orthology group: None (inferred from 98% identity to ddd:Dda3937_00554)

Predicted SEED Role

"MFS permease"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4C979 at UniProt or InterPro

Protein Sequence (380 amino acids)

>DZA65_RS20685 MFS transporter (Dickeya dianthicola ME23)
MMPRLLPTLLIMQTFLIQLVSGINYVTIPVLMNLQGHNNLWIGVAMACEIIGVLLFHQRL
SRIIQRMGLMWSTLLLVLLRACLCASMAWQQFYPGWLVSILGYGLCTGMQLILLQTWLNQ
LPLRRRGIIMGLFSAALSLGVALGPVLLQLTQVSMSQRFWLTALLSLSALLLVWIAHINP
LSGTVSVVRFRFVCRHARAILVSALVGGVSFYGLPNFLTLYGISDGLTEERASLLMTMFM
LGSVTLGMLVSLLSDWVNRQWIVVFCIFCSVVCAVFLALAVYADYGATLVLLYVWGGSMG
GVYSIGLSLIGDRFHPQQQMSANMSYTMMDSLGGIGGLIGIGFMMDRMGPEGMTMVLVAV
GCAFLGYLVWELVEHQTPFQ