Protein Info for DZA65_RS20645 in Dickeya dianthicola ME23

Annotation: OsmC family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 135 PF02566: OsmC" amino acids 30 to 127 (98 residues), 74.2 bits, see alignment E=4.8e-25

Best Hits

Swiss-Prot: 91% identical to YHFA_ECOL6: Protein YhfA (yhfA) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K07397, putative redox protein (inferred from 96% identity to ddd:Dda3937_00545)

Predicted SEED Role

"OsmC/Ohr family protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4CMY6 at UniProt or InterPro

Protein Sequence (135 amino acids)

>DZA65_RS20645 OsmC family protein (Dickeya dianthicola ME23)
MQARVKWVEGLTFLGESASGHQLLMDGNAGDKAPSPMEMVLMAAGGCSAIDVVSILQKGR
HDVVDCEVRLTSERREEAPRLFTAINLHFIVTGKGLSDKAVERAVSLSAEKYCSVALMLE
KAVNITHSHEVVALD