Protein Info for DZA65_RS20605 in Dickeya dianthicola ME23

Annotation: peptidylprolyl isomerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 194 PF00254: FKBP_C" amino acids 4 to 98 (95 residues), 34.1 bits, see alignment E=1.4e-12

Best Hits

Swiss-Prot: 86% identical to SLYD_ECO57: FKBP-type peptidyl-prolyl cis-trans isomerase SlyD (slyD) from Escherichia coli O157:H7

KEGG orthology group: K03775, FKBP-type peptidyl-prolyl cis-trans isomerase SlyD [EC: 5.2.1.8] (inferred from 96% identity to ddd:Dda3937_00536)

MetaCyc: 86% identical to FKBP-type peptidyl-prolyl cis-trans isomerase SlyD (Escherichia coli K-12 substr. MG1655)
Peptidylprolyl isomerase. [EC: 5.2.1.8]; RXN-22956 [EC: 5.2.1.8]

Predicted SEED Role

"FKBP-type peptidyl-prolyl cis-trans isomerase SlyD (EC 5.2.1.8)" in subsystem Peptidyl-prolyl cis-trans isomerase or Potassium homeostasis (EC 5.2.1.8)

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 5.2.1.8

Use Curated BLAST to search for 5.2.1.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4CPB1 at UniProt or InterPro

Protein Sequence (194 amino acids)

>DZA65_RS20605 peptidylprolyl isomerase (Dickeya dianthicola ME23)
MKVAKDLVVSLAYQVRTEDGVLVDESPVSAPLDYLHGHGSLISGLEKALEGRAAGERFDV
SVGANDAYGEYDDNLVQRVPKDVFVGVDELQVGMRFLADTDQGPVPVEITEVQDEHVMVD
GNHMLAGQNLKFNVEVVAIREATEEELAHGHVHGEHDHDHDHDGCCGGHGHDHDHDHDHG
KGGCGGNGGCGCHH