Protein Info for DZA65_RS20410 in Dickeya dianthicola ME23

Annotation: 50S ribosomal protein L15

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 144 TIGR01071: ribosomal protein uL15" amino acids 2 to 143 (142 residues), 169.3 bits, see alignment E=2.3e-54 PF00828: Ribosomal_L27A" amino acids 84 to 143 (60 residues), 49.9 bits, see alignment E=1.8e-17

Best Hits

Swiss-Prot: 95% identical to RL15_PECAS: 50S ribosomal protein L15 (rplO) from Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)

KEGG orthology group: K02876, large subunit ribosomal protein L15 (inferred from 90% identity to ypb:YPTS_3871)

MetaCyc: 89% identical to 50S ribosomal subunit protein L15 (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"LSU ribosomal protein L15p (L27Ae)" in subsystem Ribosome LSU bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4D6V9 at UniProt or InterPro

Protein Sequence (144 amino acids)

>DZA65_RS20410 50S ribosomal protein L15 (Dickeya dianthicola ME23)
MRLNTLSPAEGAKHAPKRVGRGIGSGLGKTGGRGVKGQNSRSGGGVRRGFEGGQMPLYRR
LPKFGFTSRKAMVTAEIRLSDLARVEGDVVDLNTLKAANVIGVQIEFAKVILSGEVARPV
TIRGLRVTKGARAAIEAAGGKIEE