Protein Info for DZA65_RS20410 in Dickeya dianthicola ME23
Annotation: 50S ribosomal protein L15
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 95% identical to RL15_PECAS: 50S ribosomal protein L15 (rplO) from Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
KEGG orthology group: K02876, large subunit ribosomal protein L15 (inferred from 90% identity to ypb:YPTS_3871)MetaCyc: 89% identical to 50S ribosomal subunit protein L15 (Escherichia coli K-12 substr. MG1655)
Predicted SEED Role
"LSU ribosomal protein L15p (L27Ae)" in subsystem Ribosome LSU bacterial
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A0A3A4D6V9 at UniProt or InterPro
Protein Sequence (144 amino acids)
>DZA65_RS20410 50S ribosomal protein L15 (Dickeya dianthicola ME23) MRLNTLSPAEGAKHAPKRVGRGIGSGLGKTGGRGVKGQNSRSGGGVRRGFEGGQMPLYRR LPKFGFTSRKAMVTAEIRLSDLARVEGDVVDLNTLKAANVIGVQIEFAKVILSGEVARPV TIRGLRVTKGARAAIEAAGGKIEE