Protein Info for DZA65_RS20110 in Dickeya dianthicola ME23

Annotation: amino acid adenylation domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 511 PF00501: AMP-binding" amino acids 20 to 365 (346 residues), 249.8 bits, see alignment E=4.3e-78 TIGR01733: amino acid adenylation domain" amino acids 39 to 437 (399 residues), 337.2 bits, see alignment E=6.4e-105 PF13193: AMP-binding_C" amino acids 423 to 500 (78 residues), 35.6 bits, see alignment E=1.5e-12

Best Hits

KEGG orthology group: None (inferred from 55% identity to enc:ECL_03954)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A385Y4Z2 at UniProt or InterPro

Protein Sequence (511 amino acids)

>DZA65_RS20110 amino acid adenylation domain-containing protein (Dickeya dianthicola ME23)
MNTDAPSSIPSKTLLGCFLDVADRYPERIAVKDGETSTTYHVLKARVLSIASALRNQGVE
PGHRVAVELTPSADLIAALLAVQYAGAAYVPLDKKAPLERNRLIVDDAKPVLTISDSDIS
SLYYIDHVSIQTLTSAAASTNLGDHSRLDNTAYIIYTSGTTGKPKGVPITHSNLAALFCV
TDSLFHFSHQDATLLYHSYAFDFSVWEIWSVLGYGGKLVIPDEAIKIVPHALAELIKEEN
ITLLNQTPTAFSVNAEKLCQFQPEELSLRCIIFGGERLNFQTLKLWSKHFGLRSPILVNM
YGITETTVHASWHIVNEADLMNPESNIGWVLPHFHYMIRPLGNELSIESGGELLLSGPQV
TNGYLNTENDNGNKFIWLETEGVSQRYYCSGDVVKHTPKGELIYLGRCDEQVKINGFRIE
TGEIESVLAQLEDIDDISVLAAKTDIHGHHLIGFFTSSSAQDEEEIKEKLKSQARLALPI
YMRPLRYRRIDVMPKTVNGKIDKKLILHSME