Protein Info for DZA65_RS20100 in Dickeya dianthicola ME23

Annotation: chlorinating enzyme

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 319 TIGR01762: chlorinating enzyme" amino acids 6 to 298 (293 residues), 446 bits, see alignment E=3e-138 PF05721: PhyH" amino acids 15 to 250 (236 residues), 139 bits, see alignment E=1.4e-44

Best Hits

KEGG orthology group: None (inferred from 81% identity to enc:ECL_03956)

MetaCyc: 61% identical to L-threonyl-[L-threonyl-carrier protein] 4-chlorinase (Pseudomonas syringae pv. syringae)
RXN-19538 [EC: 1.14.20.15]

Predicted SEED Role

"CmaB"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.14.20.15

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A385Y252 at UniProt or InterPro

Protein Sequence (319 amino acids)

>DZA65_RS20100 chlorinating enzyme (Dickeya dianthicola ME23)
MSKTLHLTEEQVDSFHRNGYIGPLTIYSPDEMNDIWNKVRRQLPDRSNAAYPADSYSAAT
NISNYDRHLDIELLSQHITNPRIVAPVADILGQDVLCWRTEFFPKYPGDEGTDWHQADTF
ANASGKPQILWPGETEDRFGKGTLTVWTAFTDATIENGCLEIMPGTHHKMNYDETKAMAY
QTEMINNQAKEGKKRGFFGYDYRELQIEPDWKPDESQAFPLVMKAGQCVIFWSTLMHASY
PNSSKKDFRMGFATRYAPSIVDIYPDTDVVEEYGGRIPLDKYGCVIVSGQSLNARNRIAS
NNLLGKPFIPLAESRQTGA