Protein Info for DZA65_RS20090 in Dickeya dianthicola ME23

Annotation: DMT family transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 306 transmembrane" amino acids 12 to 31 (20 residues), see Phobius details amino acids 38 to 63 (26 residues), see Phobius details amino acids 75 to 95 (21 residues), see Phobius details amino acids 101 to 119 (19 residues), see Phobius details amino acids 131 to 149 (19 residues), see Phobius details amino acids 158 to 177 (20 residues), see Phobius details amino acids 188 to 209 (22 residues), see Phobius details amino acids 225 to 246 (22 residues), see Phobius details amino acids 256 to 275 (20 residues), see Phobius details amino acids 281 to 300 (20 residues), see Phobius details PF00892: EamA" amino acids 18 to 147 (130 residues), 37 bits, see alignment E=2e-13 amino acids 158 to 295 (138 residues), 54.4 bits, see alignment E=8.4e-19

Best Hits

KEGG orthology group: None (inferred from 75% identity to xbo:XBJ1_0482)

Predicted SEED Role

"Permease of the drug/metabolite transporter (DMT) superfamily" in subsystem Queuosine-Archaeosine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4CH13 at UniProt or InterPro

Protein Sequence (306 amino acids)

>DZA65_RS20090 DMT family transporter (Dickeya dianthicola ME23)
MSNETTLHLSRSRLYLVDLGLLTVALSWGASYSLMQMIIHAGVAVPLFLMLRFALAVPFM
FLGTRIRLRDFTRGEVLNGVIFGALLYAILTLETLGVKYTTAANAGFLIALSVVLVPFYE
RVLGKRRQNKLIYVTCVLSLAGGSLISFSHSGPIGFNFGDWLVLLAALIRGFQIFMFGRQ
TAGKSYSLINITLVELLTVAALGLLFICVSDPASMQAIPAIPLDIWGYILFLSVLATAFA
FLMQLYAAKLTSPTRVGLILSMEPVFAAGFAVTLMGEVIGIWQGIGGAIIVSAALAGRML
EGKRYE