Protein Info for DZA65_RS20010 in Dickeya dianthicola ME23

Annotation: protein nifY

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 220 PF02579: Nitro_FeMo-Co" amino acids 103 to 187 (85 residues), 61.1 bits, see alignment E=5.1e-21

Best Hits

Swiss-Prot: 62% identical to NIFY_KLEPN: Protein NifY (nifY) from Klebsiella pneumoniae

KEGG orthology group: None (inferred from 93% identity to ddd:Dda3937_02159)

Predicted SEED Role

"Nitrogenase FeMo-cofactor carrier protein NifX" in subsystem Nitrogen fixation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4C9E9 at UniProt or InterPro

Protein Sequence (220 amino acids)

>DZA65_RS20010 protein nifY (Dickeya dianthicola ME23)
MSDDDVLFWRLFALIQCLPELPPPRLLGWLGDGDEASLEADRLASLTQTALAARFPLDAD
AMTPARWRTVMDCLRGVLPAHLAVAAPARRRPQLLAAFASQDGLTINGHFGQCRLFFIYA
FDQDGSWLHDLRRYQPAGGEQEGNEVRSALLNDCHLLFCEAIGGPAAARIIRHNIHPVKV
APGSQIQPQRDALQTLLAGTLPPWLAKRLEKGNPLENRVF