Protein Info for DZA65_RS19945 in Dickeya dianthicola ME23

Annotation: nitrogen fixation protein NifM

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 261 TIGR02933: nitrogen fixation protein NifM" amino acids 8 to 261 (254 residues), 323.3 bits, see alignment E=7.6e-101 PF13145: Rotamase_2" amino acids 110 to 237 (128 residues), 58.3 bits, see alignment E=2e-19 PF13616: Rotamase_3" amino acids 128 to 223 (96 residues), 43.9 bits, see alignment E=5.1e-15 PF00639: Rotamase" amino acids 135 to 224 (90 residues), 72.4 bits, see alignment E=7.9e-24

Best Hits

Swiss-Prot: 50% identical to NIFM_KLEPN: Putative peptidyl-prolyl cis-trans isomerase NifM (nifM) from Klebsiella pneumoniae

KEGG orthology group: K03769, peptidyl-prolyl cis-trans isomerase C [EC: 5.2.1.8] (inferred from 90% identity to ddd:Dda3937_02176)

Predicted SEED Role

"NifM protein" in subsystem Nitrogen fixation

Isozymes

Compare fitness of predicted isozymes for: 5.2.1.8

Use Curated BLAST to search for 5.2.1.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A385Y258 at UniProt or InterPro

Protein Sequence (261 amino acids)

>DZA65_RS19945 nitrogen fixation protein NifM (Dickeya dianthicola ME23)
MTPPAWQRFSRLRLAQTRWHCAPEQLPEPERPRFERQLLRQLALEQAVTAAARRQSLTAT
AAQLQQVAQQLAQELVCAGFSADEQQAIVWHHALMELQLASVGAQAGEPQPAEIQRWYQQ
HADRFRRPEQRLTRHLLLTVDDNRPAVEQQMAGVLRQLRAEPDGFASLAQRHSHCPTALD
GGLMGWVSRGLLFPALERCLFALAAGELSEPVETELGLHLLRCDAIRPAAPLPEAEALVR
AGDYLRSQRQRRHQRRWLQTL