Protein Info for DZA65_RS19885 in Dickeya dianthicola ME23

Annotation: p-aminobenzoyl-glutamate transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 507 transmembrane" amino acids 30 to 52 (23 residues), see Phobius details amino acids 85 to 105 (21 residues), see Phobius details amino acids 121 to 140 (20 residues), see Phobius details amino acids 143 to 160 (18 residues), see Phobius details amino acids 166 to 191 (26 residues), see Phobius details amino acids 214 to 232 (19 residues), see Phobius details amino acids 262 to 281 (20 residues), see Phobius details amino acids 300 to 322 (23 residues), see Phobius details amino acids 343 to 362 (20 residues), see Phobius details amino acids 382 to 403 (22 residues), see Phobius details amino acids 411 to 434 (24 residues), see Phobius details amino acids 440 to 458 (19 residues), see Phobius details amino acids 470 to 495 (26 residues), see Phobius details TIGR00819: AbgT transporter family" amino acids 8 to 506 (499 residues), 757.1 bits, see alignment E=4.6e-232 PF03806: ABG_transport" amino acids 15 to 506 (492 residues), 640.9 bits, see alignment E=5.4e-197

Best Hits

Swiss-Prot: 75% identical to ABGT_ECOLI: p-aminobenzoyl-glutamate transport protein (abgT) from Escherichia coli (strain K12)

KEGG orthology group: K12942, aminobenzoyl-glutamate transport protein (inferred from 97% identity to ddd:Dda3937_00463)

MetaCyc: 75% identical to p-aminobenzoyl glutamate:H+ symporter (Escherichia coli K-12 substr. MG1655)
TRANS-RXN0-452

Predicted SEED Role

"Aminobenzoyl-glutamate transport protein" in subsystem p-Aminobenzoyl-Glutamate Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4D2E5 at UniProt or InterPro

Protein Sequence (507 amino acids)

>DZA65_RS19885 p-aminobenzoyl-glutamate transporter (Dickeya dianthicola ME23)
MSVTAESRQPQPGGLFQWVERVGNKIPNPFLLFVYLIVALMAASALFSWFGITAANPANG
EVVRVKNLLSVEGLQWMLPNIIKNFSAFTPLGAILALVLGAGLAERVGLLQTLMYKMASR
VNARYASYMVLFIAFFSHISSDAALVVMPPLGALIFLAVGRHPVAGLLAAIAGVGSGFTA
NLLIVTTDVLLSGLSTESAKVINPAVHVSVIDNWFFMAASVVVLTIAGALLTDKFIEPRL
PPYQGERHEHLSRLTPEQNRGLRASGIAALAFIALVALLVVPEWGPLRDPVKHSVMPSPF
IQGIVPLIIAFFFVVSIPYGMVTGQIKSQNDLPQLMVDPMKGMAGFIVMVFPLSQFVAFF
NWSNMGKFIAIGLTDLLESLGMTGIPAFVGLIFLSAFLCMFIASGSAIWSILAPIFVPMF
MLLGFHPAFAQIVFRVADSSVIPLAPVSPFVPLFLGFLQRYHKEAQLGTYYSLVLPYPLV
FFTLWLALLVVWYLLGLPIGPGVYPHL