Protein Info for DZA65_RS19840 in Dickeya dianthicola ME23

Annotation: LLM class flavin-dependent oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR03558: luciferase family oxidoreductase, group 1
  • amino acids 5 to 324 (320 residues), 334.6 bits, E=3.1e-104
• PF00296: Bac_luciferase
  • amino acids 12 to 298 (287 residues), 105.8 bits, E=1.5e-34

Best Hits

KEGG orthology group: None (inferred from 92% identity to ddd:Dda3937_00453)

Predicted SEED Role

"Bacterial luciferase family protein YtmO, in cluster with L-cystine ABC transporter"

Sequence Analysis Tools

See A0A385Y240 at UniProt or InterPro

Protein Sequence (333 amino acids)

>DZA65_RS19840 LLM class flavin-dependent oxidoreductase (Dickeya dianthicola ME23)
MSYRLGLLDQSPIAEGMTAADALARTVELASLADASGYSRFWVSEHHNSDSLAGSSPEVL
IAWLLAHTRHIRIGSGGVMLQHYSPYKVAENFHVLSSLAPERVDLGVGKAPGGFPLSTRA
LQQEVDPAHQVSFADKLRQLHELLEPASALNTDLRATPSPPVPPARFLLGASAESARLAA
SLGWNFVFAGFIQPSETLLTDALLTWREYQPEQAQALLSLSVIVADSHDEAKTLAGERYN
YRVYIEDRAPLNVLTQEQADTLVQQSGSTQFRIEKQAQNILYGTTAEVHRQLQHYHQRFG
VSEFIIHTPVSDPAARLTSIRGLAAGLRAQDSR