Protein Info for DZA65_RS19810 in Dickeya dianthicola ME23

Annotation: biotin-dependent carboxyltransferase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 328 TIGR00724: biotin-dependent carboxylase uncharacterized domain" amino acids 1 to 319 (319 residues), 303.9 bits, see alignment E=5.6e-95 PF02626: CT_A_B" amino acids 24 to 294 (271 residues), 291 bits, see alignment E=5.3e-91

Best Hits

KEGG orthology group: None (inferred from 82% identity to kva:Kvar_4113)

Predicted SEED Role

"Allophanate hydrolase 2 subunit 2 (EC 3.5.1.54)" (EC 3.5.1.54)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.5.1.54

Use Curated BLAST to search for 3.5.1.54

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A385Y1X0 at UniProt or InterPro

Protein Sequence (328 amino acids)

>DZA65_RS19810 biotin-dependent carboxyltransferase family protein (Dickeya dianthicola ME23)
MIVIEQSAALNTVQDLGRPAWRHLGVSVSGGMDPLALRAGNILLGNDENAAAIEVQMFPF
RVRFQVDTCIAVTGADCRARLDGVDLPAWWGCQVHKGQVLELRFPRSGARGYLCVAGGID
VPQVLGSRSTALRGSFGGINGRPLRRGDILSCAPSHGLPLPPSGIGIEPPETALQVFFPR
NEQGYAQIRAIPSGEYALFAADAPRFWRQSWKISMQSNRTGYRLSGEPILAAETVEMRSY
GLIPGIVQVPPVGEPIIQLSDANTAGGYPKIACVIEEDLWRLGQLQAGQFIQLVPCDART
AITVKQAIENWLQRLRTSVVSLKNVVGL