Protein Info for DZA65_RS19780 in Dickeya dianthicola ME23

Annotation: amino acid ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 231 transmembrane" amino acids 23 to 45 (23 residues), see Phobius details amino acids 58 to 80 (23 residues), see Phobius details amino acids 91 to 114 (24 residues), see Phobius details amino acids 164 to 185 (22 residues), see Phobius details amino acids 199 to 222 (24 residues), see Phobius details TIGR01726: amino ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family" amino acids 15 to 120 (106 residues), 59 bits, see alignment E=2.6e-20 PF00528: BPD_transp_1" amino acids 38 to 226 (189 residues), 63.6 bits, see alignment E=1e-21

Best Hits

KEGG orthology group: K10040, putative glutamine transport system permease protein (inferred from 89% identity to kva:Kvar_4107)

Predicted SEED Role

"Glutamate Aspartate transport system permease protein GltJ (TC 3.A.1.3.4)" (TC 3.A.1.3.4)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4D2G8 at UniProt or InterPro

Protein Sequence (231 amino acids)

>DZA65_RS19780 amino acid ABC transporter permease (Dickeya dianthicola ME23)
MALDFSSVMTDHFGQMIIDGTVVTLELALGAWLLAMFIALALVVVRLSNKRTAQLLVAAY
VSYHRNVPTLIQLMMWYFAIPTVLPESLQMWINGFNAEFLFSLVALGVCQAAYFSEDIRS
GLRAIPHGQNEAARALGMSYMRAMWLVSLPQGIRNALPSIINHSVLLFKNTSLAMVIGVA
ELTYVTRNIENQTFRTFEAYVVTTAGYLAFSLVLMGVGALLARRFQRVYAR