Protein Info for DZA65_RS19770 in Dickeya dianthicola ME23

Annotation: amino acid ABC transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 245 PF00005: ABC_tran" amino acids 20 to 168 (149 residues), 129.8 bits, see alignment E=1.1e-41 PF13304: AAA_21" amino acids 130 to 200 (71 residues), 28.5 bits, see alignment E=1.5e-10

Best Hits

Swiss-Prot: 59% identical to GLNQ_GEOSE: Glutamine transport ATP-binding protein GlnQ (glnQ) from Geobacillus stearothermophilus

KEGG orthology group: None (inferred from 92% identity to kva:Kvar_4105)

MetaCyc: 60% identical to glutamate/aspartate ABC transporter ATP binding subunit (Escherichia coli K-12 substr. MG1655)
ABC-13-RXN [EC: 7.4.2.1]; 7.4.2.1 [EC: 7.4.2.1]

Predicted SEED Role

"Glutamate Aspartate transport ATP-binding protein GltL (TC 3.A.1.3.4)" (TC 3.A.1.3.4)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.4.2.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4CGC0 at UniProt or InterPro

Protein Sequence (245 amino acids)

>DZA65_RS19770 amino acid ABC transporter ATP-binding protein (Dickeya dianthicola ME23)
MRPIILFNQVNKWYGEYQALTEVSAEIKTGEVVVVCGPSGSGKSTLIRTVNRLEPIEQGQ
ILFDGIDIHGTSTRLNQLRTRIGFVFQSFNLFPHVSVLENIMMSPVKVLGVKRAEARKYA
GELLERVGLSHKADAYPAQLSGGQQQRVAIARALAMKPPVMLFDEPTSALDPEMVGEVLN
AMRGLAKEGMTMICVTHEMNFARDVADTIWFMDQGQILEKATPENFFTAPRHPRARRFLN
DLLAH