Protein Info for DZA65_RS19670 in Dickeya dianthicola ME23

Annotation: FtsH protease activity modulator HflK

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 420 transmembrane" amino acids 75 to 95 (21 residues), see Phobius details PF12221: HflK_N" amino acids 1 to 57 (57 residues), 57.8 bits, see alignment 8.2e-20 TIGR01933: HflK protein" amino acids 92 to 351 (260 residues), 401.3 bits, see alignment E=9.4e-125 PF01145: Band_7" amino acids 94 to 266 (173 residues), 116.4 bits, see alignment E=1.5e-37

Best Hits

Swiss-Prot: 75% identical to HFLK_ECO57: Protein HflK (hflK) from Escherichia coli O157:H7

KEGG orthology group: K04088, membrane protease subunit HflK [EC: 3.4.-.-] (inferred from 98% identity to ddd:Dda3937_00432)

MetaCyc: 75% identical to regulator of FtsH protease (Escherichia coli K-12 substr. MG1655)
3.4.24.-

Predicted SEED Role

"HflK protein" in subsystem Hfl operon

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.4.-.-

Use Curated BLAST to search for 3.4.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4C582 at UniProt or InterPro

Protein Sequence (420 amino acids)

>DZA65_RS19670 FtsH protease activity modulator HflK (Dickeya dianthicola ME23)
MAWNQPGNNGQDRDPWGSSNNNSGNSGGNNKGGRDQGPPDLDDIFRKLSKKLGELGGKSS
GSGSSQGSGGNGGRILGLVVAAAVVVWGVSGFYTIKEAERGVVTRFGKFSHLVGPGLNWK
PTFVDSVRAVNVESVRELATSGVMLTSDENVVRVEMNVQYRVTQPDKYLFSVTNADDSLR
QATDSALRGVIGKYTMDKILTEGRTIVRTDTQRVLEETVRPYDMGITLLDVNFQTARPPE
EVKAAFDDAIAARENEQQYIREAEAYANEVQPRANGQAQRILEESRAYKDRTVLEAQGEV
SRFSRLLPEYKAAPEITRERLYIETMERVLSHTNKVLVSDKSNNLMVLPLDQLMRGQGGV
SPSAPTSGNAANPAPLRLPSTSSNSSGVGYAPRSSGNNGNIMDQRRANAQRDENIRVGRE