Protein Info for DZA65_RS19505 in Dickeya dianthicola ME23

Annotation: MDR efflux pump AcrAB transcriptional activator RobA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 285 PF12833: HTH_18" amino acids 28 to 105 (78 residues), 75.2 bits, see alignment E=8.4e-25 PF00165: HTH_AraC" amino acids 69 to 105 (37 residues), 33.1 bits, see alignment 9.6e-12 PF06445: GyrI-like" amino acids 127 to 283 (157 residues), 81.5 bits, see alignment E=1.6e-26 PF14526: Cass2" amino acids 131 to 283 (153 residues), 42.3 bits, see alignment E=1.9e-14

Best Hits

Swiss-Prot: 69% identical to ROB_ECOLI: Right origin-binding protein (rob) from Escherichia coli (strain K12)

KEGG orthology group: K05804, right origin-binding protein (inferred from 95% identity to ddd:Dda3937_00398)

Predicted SEED Role

"Right origin-binding protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4D0C4 at UniProt or InterPro

Protein Sequence (285 amino acids)

>DZA65_RS19505 MDR efflux pump AcrAB transcriptional activator RobA (Dickeya dianthicola ME23)
MDQASIIHDLLNWLEGHLDQPLSLDNVAAKAGYSKWHLQRMFKDVTGHAIGSYIRARRLT
KAAVALCLTSRPILDIALQYRFDSQQTFTRAFKKQFAQTPASYRRSDDWNTFGIHPPIRL
GAFTMPQPQFVTLPETQLVGLTQSYTCNLEQITCFRTEIRIHFWRQYLGEAKQIPPVLYG
LHHSRPSKEKDDEHEVLYTTALEPHHVPEGVRPGEPATLPGGDYALFIYEGPTDDLQDFI
ITLYDTCLPTYKLTRRKGFDAERFYPKDAEPPKILRCEYLIPIQR